Rv0201c Family assigned · low

H37Rv Rv0201c · MTBC0 mtbc0_000215 · 167 aa · 238244–238747 (-) · RefSeq NP_214715.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationXRE family transcriptional regulator
Revised (this work)XRE/Cro-family helix-turn-helix transcriptional regulator (PGAP). No Pfam domain above threshold, but Foldseek strongly matches DNA-binding folds (prob 1.00, TM=0.81). Putative DNA-binding regulator.

Curated reference (UniProt)

UniProt O53652 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2E42V

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.09 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 94.9 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8tac-assembly2_B 1.00 0.81 3.0e-01 8tac-assembly2_B Designed DNA binding protein
1y7y-assembly1_A 1.00 0.78 3.0e-01 1y7y-assembly1_A High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila
3f52-assembly1_E 1.00 0.86 5.3e-01 3f52-assembly1_E Crystal structure of the clp gene regulator ClgR from C. glutamicum
1y9q-assembly1_A-2 1.00 0.83 5.6e-01 1y9q-assembly1_A-2 Crystal Structure of HTH_3 family Transcriptional Regulator from Vibrio cholerae
3vk0-assembly2_B 1.00 0.83 4.8e-01 3vk0-assembly2_B Crystal Structure of hypothetical transcription factor NHTF from Neisseria
6jq1-assembly1_A 1.00 0.84 5.6e-01 6jq1-assembly1_A Crystal Structure of DdrO from Deinococcus geothermalis
2b5a-assembly1_A 1.00 0.77 3.9e-01 2b5a-assembly1_A C.BclI, Control Element of the BclI Restriction-Modification System
2ef8-assembly1_B 1.00 0.86 6.8e-01 2ef8-assembly1_B Crystal structure of C.EcoT38IS

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmpL11 (transmembrane transport protein MmpL11), high confidence from genomic context alone (score 883 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0202c mmpL11 transmembrane transport protein MmpL11 931 883 ctx neighborhood:881 textmining:438
Rv0203 hyp hypothetical protein 713 513 ctx neighborhood:506 textmining:435
Rv0204c transmembrane protein 496 66 textmining:483
Rv0205 transmembrane protein 807 64 textmining:803
Rv0200 transmembrane protein 658 55 textmining:653
Rv0199 membrane protein 483 49 textmining:479
Rv0208c trmB tRNA (guanine-N(7)-)-methyltransferase 657 47 textmining:655
Rv3444c esxT ESAT-6 like protein EsxT 520 47 textmining:517
Rv1972 Mce associated membrane protein 758 44 textmining:758
Rv0177 Mce associated protein 650 41 textmining:650
Rv3812 PE_PGRS62 PE-PGRS family protein PE_PGRS62 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'XRE family transcriptional regulator'
  • Pfam: none above threshold
  • Foldseek on the ESMFold model: strong match to DNA-binding domains (TM=0.81)

ESM Atlas signal (exploratory)

Ancestral protein hash a7da9e0403c5b1957104e25e4e1b4a76 · 10 ESM-space neighbours (max similarity 0.948). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
14744 0.98 Regulatory and DNA-contact interfaces
24410 0.80 Basic HTH/winged-helix hairpin
36264 0.79 N-terminal basic tails
413912 0.78 HTH DNA recognition helices
510141 0.65 DNA/RNA-binding regulatory modules
62405 0.65 HTH/homeodomain recognition helix
78295 0.64 HTH/homeodomain recognition helix
82674 0.64 Short basic helix–loop motif

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214715.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E42V
  • Curated reference: UniProt O53652 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 94.9, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor mmpL11
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000215|Rv0201c|
MTLAAEPHPAPPQQPTVAWSEPDVDRRVEFWPTVAIRSALESGDIATWQRIAAALKRDPYGRTARQVEEVLEGIPATGIANAFWEVLDRARTHLDANERAEVARQVGLLLDRSGLQRQEFASRIGVTAQDLTAYLDGIVSPSASLMIRMRRLSDRFVRAKSVRAADS