Rv0216 Family assigned · low auto-curated
H37Rv Rv0216 · MTBC0 mtbc0_000230 ·
337 aa · 259294–260307 (+) ·
RefSeq NP_214730.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hydratase |
|---|---|
| MTBC0 PGAP re-annotation | MaoC family dehydratase |
| Revised (this work) | MaoC family dehydratase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y340
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Double hotdog hydratase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Acyl dehydratase |
| Orthologous group | COG2030 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.147 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadE3 (Rv0215c, (MTCY08D5.10c), len: 357 aa. Probable fadE3, acyl- dehydrogenase, similar to many e.g. ACDB_BACSU|P45857 acyl-CoA dehydrogenase fro), high confidence from genomic context alone (score 911 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0215c fadE3 |
Rv0215c, (MTCY08D5.10c), len: 357 aa. Probable fadE3, acyl- dehydrogenase, similar to many e.g. ACDB_BACSU|P45857 acyl-CoA dehydrogenase fro | 914 | 911 ctx | neighborhood:787 |
Rv3339c icd1 |
isocitrate dehydrogenase | 645 | 632 | database:476 |
Rv0673 echA4 |
enoyl-CoA hydratase EchA4 | 577 | 575 | |
Rv0860 fadB |
fatty oxidation protein FadB | 588 | 562 | |
Rv0456c echA2 |
enoyl-CoA hydratase EchA2 | 552 | 550 | |
Rv0125 pepA |
serine protease PepA | 550 | 550 | database:498 |
Rv3671c marP |
serine protease | 550 | 550 | database:498 |
Rv1223 htrA |
serine protease HtrA | 548 | 549 | database:498 |
Rv1043c hyp |
hypothetical protein | 548 | 549 | database:498 |
Rv0983 pepD |
serine protease PepD | 548 | 549 | database:498 |
Rv2482c plsB2 |
glycerol-3-phosphate acyltransferase | 542 | 525 | |
Rv0231 fadE4 |
acyl-CoA dehydrogenase FadE4 | 528 | 510 | |
Rv1679 fadE16 |
acyl-CoA dehydrogenase FadE16 | 527 | 509 | |
Rv3797 fadE35 |
acyl-CoA dehydrogenase FadE35 | 524 | 506 | |
Rv1934c fadE17 |
acyl-CoA dehydrogenase FadE17 | 524 | 506 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hydratase
- MTBC0 PGAP product: MaoC family dehydratase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214730.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2030 - Curated reference: UniProt I6Y340 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
122 functional partner(s); context anchor
fadE3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000230|Rv0216| MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVGNRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPAVGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWKPGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSGAPELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTAPVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF