omamA Resolved · high

H37Rv Rv0199 · MTBC0 mtbc0_000213 · 219 aa · 236902–237561 (+) · RefSeq NP_214713.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Mce-associated membrane (Mam) protein OmamA (orphaned Mam protein A), an exported virulence factor that stabilises the Mce lipid-transport complexes. RefSeq leaves this locus 'hypothetical protein'; here it is re-annotated from published genetics/cell biology. Rv0199 is required for cholesterol import (a Mce4-dependent process) and stabilises protein components of the Mce1 transporter complex, a role proposed to be analogous to VirB8 in stabilising Type-IV secretion systems (Perkowski 2016). It was independently identified as an exported, intracellular-growth factor (β-lactamase reporter transposon screen; attenuated macrophage growth) (McCann 2011). Experimentally characterised, not a structural prediction.

Curated reference (UniProt)

UniProt O53650 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BKG3

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.344 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0200 (transmembrane protein), high confidence from genomic context alone (score 885 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0200 transmembrane protein 955 885 ctx neighborhood:882 textmining:622
Rv0198c zmp1 zinc metalloprotease 795 784 ctx neighborhood:759
Rv2048c pks12 polyketide synthase 764 737 experimental:470 database:508
Rv2940c mas multifunctional mycocerosic acid synthase 763 735 experimental:470 database:508
Rv1527c pks5 polyketide synthase 763 735 experimental:470 database:508
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 763 735 experimental:470 database:508
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 767 734 experimental:470 database:508
Rv2267c stf3 hyp hypothetical protein 740 730 experimental:417 database:540
Rv1691 hyp hypothetical protein 740 730 experimental:417 database:540
Rv3529c hyp hypothetical protein 740 729 experimental:417 database:540
Rv1663 pks17 polyketide synthase 737 727 experimental:458 database:508
Rv1334 mec [CysO 728 718 experimental:404 database:546
Rv1277 hyp hypothetical protein 702 703 experimental:438 database:493
Rv3696c glpK glycerol kinase 707 695 database:502
Rv1389 gmk guanylate kinase 701 689 experimental:411 database:491

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • RefSeq: hypothetical / exported membrane protein of unknown function
  • Mce-associated membrane (Mam) family; renamed OmamA
  • Required for cholesterol import (Mce4-dependent); stabilises the Mce1 transporter complex (Perkowski 2016, PMID 26712165)
  • Exported protein with a role in intracellular growth; attenuated in macrophages (McCann 2011, PMID 21148733)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214713.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BKG3
  • Curated reference: UniProt O53650 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 242 functional partner(s); context anchor Rv0200
  • Primary literature: Perkowski EF, Miller BK, McCann JR, Sullivan JT, Malik S, Allen IC, Godfrey V, Hayden JD, Braunstein M (2016). An orphaned Mce-associated membrane protein of Mycobacterium tuberculosis is a virulence factor that stabilizes Mce transporters Mol Microbiol 100(1):90-107. doi:10.1111/mmi.13303 PMID:26712165
  • Primary literature: McCann JR, McDonough JA, Sullivan JT, Feltcher ME, Braunstein M (2011). Genome-wide identification of Mycobacterium tuberculosis exported proteins with roles in intracellular growth J Bacteriol 193(4):854-61. doi:10.1128/JB.01271-10 PMID:21148733

Ancestral MTBC0 protein sequence

>mtbc0_000213|Rv0199|omamA
MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIASTLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQRLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVVTTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR