Rv0812 Resolved · high auto-curated
H37Rv Rv0812 · MTBC0 - ·
289 aa · 906423–907292 (+) ·
RefSeq YP_177757.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 4-amino-4-deoxychorismate lyase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | 4-amino-4-deoxychorismate lyase. Pfam: Aminotran_4 (PF01063.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FW0
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Bifunctional aminodeoxychorismate lyase / D-amino acid transaminase |
| EC (curated) |
EC 2.6.1.21, EC 4.1.3.38
|
| Curated function | Bifunctional enzyme that catalyzes two enzymatic reactions in biochemically unrelated pathways: acts as an aminodeoxychorismate (ADC) lyase (ADCL) in folate biosynthesis, converting 4-amino-4-deoxychorismate (ADC) to 4-aminobenzoate (PABA), and as a D-amino acid transaminase (DAAT) in peptidoglycan (PG) biosynthesis. DAAT activity is strictly restricted to D-alanine and D-glutamate. May function as a metabolic toggle that alternates between ADCL and DAAT activity, prioritizing the former over the latter in response to substrate accumulation. Bifunctionality of this enzyme provides a failsafe m. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolismH Coenzyme transport and metabolism
|
|---|---|
| Preferred name | pabC |
| eggNOG description | Branched-chain amino acid aminotransferase 4-amino-4-deoxychorismate lyase |
| Orthologous group | COG0115 |
| EC number |
EC 4.1.3.38
|
| KEGG orthology |
K02619
|
| KEGG pathways |
map00790
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.549 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Aminotran_4 | PF01063.25 | 4.5e-41 | 29–261 | Amino-transferase class IV |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1005c pabB |
para-aminobenzoate synthase component I | 973 | 923 | database:900 textmining:664 |
Rv3608c folP1 |
dihydropteroate synthase | 926 | 919 | database:900 |
Rv1207 folP2 |
dihydropteroate synthase | 925 | 919 | database:900 |
Rv0013 trpG |
anthranilate synthase component II | 922 | 912 | database:900 |
Rv0189c ilvD |
dihydroxy-acid dehydratase | 815 | 791 | coexpression:668 |
Rv0811c hyp |
hypothetical protein | 783 | 784 ctx | neighborhood:783 |
Rv0810c hyp |
hypothetical protein | 694 | 694 ctx | neighborhood:693 |
Rv3469c mhpE |
4-hydroxy-2-oxovalerate aldolase MhpE | 683 | 663 | coexpression:608 |
Rv3710 leuA |
2-isopropylmalate synthase | 683 | 663 | coexpression:608 |
Rv3534c hsaF |
4-hydroxy-2-oxovalerate aldolase | 682 | 662 | coexpression:607 |
Rv3470c ilvB2 |
acetolactate synthase large subunit | 590 | 566 | coexpression:405 |
Rv1820 ilvG |
acetolactate synthase large subunit IlvG | 590 | 566 | coexpression:405 |
Rv3003c ilvB1 |
acetolactate synthase large subunit IlvB | 589 | 564 | coexpression:403 |
Rv0118c oxcA |
oxalyl-CoA decarboxylase OxcA | 588 | 564 | coexpression:402 |
Rv3509c ilvX |
acetohydroxyacid synthase large subunit | 588 | 563 | coexpression:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 4-amino-4-deoxychorismate lyase
- Pfam (hmmscan --cut_ga): Aminotran_4 PF01063.25 (E=5e-41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177757.1)
- Domains: Pfam-A via hmmscan --cut_ga — Aminotran_4 (PF01063.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0115 - Curated reference: UniProt Q79FW0 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0812| MVVTLDGEILQPGMPLLHADDLAAVRGDGVFETLLVRDGRACLVEAHLQRLTQSARLMDLPEPDLPRWRRAVEVATQRWVASTADEGALRLIYSRGREGGSAPTAYVMVSPVPARVIGARRDGVSAITLDRGLPADGGDAMPWLIASAKTLSYAVNMAVLRHAARQGAGDVIFVSTDGYVLEGPRSTVVIATDGDQGGGNPCLLTPPPWYPILRGTTQQALFEVARAKGYDCDYRALRVADLFDSQGIWLVSSMTLAARVHTLDGRRLPRTPIAEVFAELVDAAIVSDR