Rv0812 Resolved · high auto-curated

H37Rv Rv0812 · MTBC0 - · 289 aa · 906423–907292 (+) · RefSeq YP_177757.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)4-amino-4-deoxychorismate lyase
MTBC0 PGAP re-annotation
Revised (this work)4-amino-4-deoxychorismate lyase. Pfam: Aminotran_4 (PF01063.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FW0 SwissProt · reviewed · Evidence at protein level
UniProt nameBifunctional aminodeoxychorismate lyase / D-amino acid transaminase
EC (curated) EC 2.6.1.21, EC 4.1.3.38
Curated functionBifunctional enzyme that catalyzes two enzymatic reactions in biochemically unrelated pathways: acts as an aminodeoxychorismate (ADC) lyase (ADCL) in folate biosynthesis, converting 4-amino-4-deoxychorismate (ADC) to 4-aminobenzoate (PABA), and as a D-amino acid transaminase (DAAT) in peptidoglycan (PG) biosynthesis. DAAT activity is strictly restricted to D-alanine and D-glutamate. May function as a metabolic toggle that alternates between ADCL and DAAT activity, prioritizing the former over the latter in response to substrate accumulation. Bifunctionality of this enzyme provides a failsafe m.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
H Coenzyme transport and metabolism
Preferred namepabC
eggNOG descriptionBranched-chain amino acid aminotransferase 4-amino-4-deoxychorismate lyase
Orthologous groupCOG0115
EC number EC 4.1.3.38
KEGG orthology K02619
KEGG pathways map00790

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.549 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aminotran_4PF01063.25 4.5e-4129–261 Amino-transferase class IV

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1005c pabB para-aminobenzoate synthase component I 973 923 database:900 textmining:664
Rv3608c folP1 dihydropteroate synthase 926 919 database:900
Rv1207 folP2 dihydropteroate synthase 925 919 database:900
Rv0013 trpG anthranilate synthase component II 922 912 database:900
Rv0189c ilvD dihydroxy-acid dehydratase 815 791 coexpression:668
Rv0811c hyp hypothetical protein 783 784 ctx neighborhood:783
Rv0810c hyp hypothetical protein 694 694 ctx neighborhood:693
Rv3469c mhpE 4-hydroxy-2-oxovalerate aldolase MhpE 683 663 coexpression:608
Rv3710 leuA 2-isopropylmalate synthase 683 663 coexpression:608
Rv3534c hsaF 4-hydroxy-2-oxovalerate aldolase 682 662 coexpression:607
Rv3470c ilvB2 acetolactate synthase large subunit 590 566 coexpression:405
Rv1820 ilvG acetolactate synthase large subunit IlvG 590 566 coexpression:405
Rv3003c ilvB1 acetolactate synthase large subunit IlvB 589 564 coexpression:403
Rv0118c oxcA oxalyl-CoA decarboxylase OxcA 588 564 coexpression:402
Rv3509c ilvX acetohydroxyacid synthase large subunit 588 563 coexpression:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 4-amino-4-deoxychorismate lyase
  • Pfam (hmmscan --cut_ga): Aminotran_4 PF01063.25 (E=5e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177757.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aminotran_4 (PF01063.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0115
  • Curated reference: UniProt Q79FW0 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0812|
MVVTLDGEILQPGMPLLHADDLAAVRGDGVFETLLVRDGRACLVEAHLQRLTQSARLMDLPEPDLPRWRRAVEVATQRWVASTADEGALRLIYSRGREGGSAPTAYVMVSPVPARVIGARRDGVSAITLDRGLPADGGDAMPWLIASAKTLSYAVNMAVLRHAARQGAGDVIFVSTDGYVLEGPRSTVVIATDGDQGGGNPCLLTPPPWYPILRGTTQQALFEVARAKGYDCDYRALRVADLFDSQGIWLVSSMTLAARVHTLDGRRLPRTPIAEVFAELVDAAIVSDR