leuD Family assigned · medium auto-curated

H37Rv Rv2987c · MTBC0 mtbc0_003172 · 198 aa · 3365342–3365938 (-) · RefSeq NP_217503.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)3-isopropylmalate dehydratase small subunit
MTBC0 PGAP re-annotation3-isopropylmalate dehydratase small subunit
Revised (this work)3-isopropylmalate dehydratase small subunit. Pfam: Aconitase_C (PF00694.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK95 SwissProt · reviewed · Evidence at protein level
UniProt name3-isopropylmalate dehydratase small subunit
EC (curated) EC 4.2.1.33
Curated functionCatalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameleuD
eggNOG descriptionCatalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate
Orthologous groupCOG0066
EC number EC 4.2.1.33, EC 4.2.1.35
KEGG orthology K01704
KEGG pathways map00290, map00660, map01100, map01110, map01210, map01230
KEGG modules M00432, M00535
Gene Ontology (34) GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006551, GO:0006807, GO:0008150, GO:0008152, GO:0008652, GO:0009058, GO:0009081 +22 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.115 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Aconitase_CPF00694.26 2.5e-241–116 Aconitase C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: leuC (3-isopropylmalate dehydratase large subunit), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2988c leuC 3-isopropylmalate dehydratase large subunit 999 1000 ctx neighborhood:849 fusion:899 cooccurence:774 coexpression:976 experimental:511 database:900 textmining:948
Rv2995c leuB 3-isopropylmalate dehydrogenase 998 996 ctx cooccurence:713 coexpression:857 database:900 textmining:700
Rv3710 leuA 2-isopropylmalate synthase 990 976 coexpression:695 database:900 textmining:616
Rv2989 transcriptional regulator 964 952 ctx neighborhood:764 coexpression:804
Rv3001c ilvC ketol-acid reductoisomerase 970 905 coexpression:848 textmining:707
Rv0189c ilvD dihydroxy-acid dehydratase 936 893 ctx cooccurence:606 coexpression:718 textmining:427
Rv3002c ilvN acetolactate synthase small subunit 895 829 coexpression:761 textmining:416
Rv2332 mez malate oxidoreductase 834 819 database:800
Rv2454c korB 2-oxoglutarate oxidoreductase subunit KorB 811 811 database:800
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 809 809 database:800
Rv1617 pykA pyruvate kinase 825 807 database:800
Rv1127c ppdK pyruvate, phosphate dikinase PpdK 809 806 database:800
Rv1872c lldD2 L-lactate dehydrogenase 803 803 database:800
Rv2241 aceE pyruvate dehydrogenase E1 component 808 801 database:800
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 801 801 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 3-isopropylmalate dehydratase small subunit
  • MTBC0 PGAP product: 3-isopropylmalate dehydratase small subunit
  • Pfam (hmmscan --cut_ga): Aconitase_C PF00694.26 (E=2e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217503.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Aconitase_C (PF00694.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0066
  • Curated reference: UniProt P9WK95 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor leuC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003172|Rv2987c|leuD
MEAFHTHSGIGVPLRRSNVDTDQIIPAVFLKRVTRTGFEDGLFAGWRSDPAFVLNLSPFDRGSVLVAGPDFGTGSSREHAVWALMDYGFRVVISSRFGDIFRGNAGKAGLLAAEVAQDDVELLWKLIEQSPGLEITANLQDRIITAATVVLPFKIDDHSAWRLLEGLDDIALTLRKLDEIEAFEGACAYWKPRTLPAP