Rv2972c Family assigned · medium auto-curated

H37Rv Rv2972c · MTBC0 mtbc0_003157 · 237 aa · 3348198–3348911 (-) · RefSeq NP_217488.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationHNH endonuclease family protein
Revised (this work)HNH endonuclease family protein. Pfam: GmrSD_C (PF07510.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X5W6 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved membrane or exported protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionProtein of unknown function (DUF1524)
Orthologous groupCOG2356

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GmrSD_CPF07510.17 4.3e-1589–224 GmrSD restriction endonucleases, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: recG (ATP-dependent DNA helicase RecG), high confidence from genomic context alone (score 929 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2973c recG ATP-dependent DNA helicase RecG 929 929 ctx neighborhood:881 coexpression:431
Rv2974c hyp hypothetical protein 809 809 ctx neighborhood:800
Rv2975c hyp hypothetical protein 801 801 ctx neighborhood:800
Rv3923c rnpA ribonuclease P protein component 684 685 coexpression:684
Rv3211 rhlE ATP-dependent RNA helicase RhlE 600 575 database:477
Rv1253 deaD ATP-dependent RNA helicase DeaD 595 570 database:477
Rv3859c gltB glutamate synthase large subunit 617 544 ctx neighborhood:544
Rv2390c hyp hypothetical protein 520 502
Rv1814 erg3 membrane-bound C-5 sterol desaturase 497 498 coexpression:498
Rv1362c membrane protein 459 439
Rv1363c membrane protein 459 439
Rv1972 Mce associated membrane protein 458 437
Rv0199 membrane protein 457 437
Rv1973 Mce associated membrane protein 457 437
Rv0178 Mce associated membrane protein 457 437

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: HNH endonuclease family protein
  • Pfam (hmmscan --cut_ga): GmrSD_C PF07510.17 (E=4e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217488.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GmrSD_C (PF07510.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2356
  • Curated reference: UniProt I6X5W6 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor recG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003157|Rv2972c|
MNRRTLLWLSAIAALALVVAYQTLGSSAGRHADEFAARAGVPTVQPGADVLAGIAVLPKRIHRYDYRRSAFGHPWDDRNDAPGGHNGCDTRDDILDRDLVDKTYVSIKRCPNAVATGTLRDPYTNTTVAFQRGASVGQSVQIDHIVPLSYAWDMGAYRWPNSERMRFANDPANLLAVQGQANQDKGDSPPAQWMPPNKAFACQYAMQFIAVLRGYSLPVDQPSSDVLRQAAATCPTG