glfT1 Resolved · high auto-curated
H37Rv Rv3782 · MTBC0 - ·
304 aa · 4228347–4229261 (+) ·
RefSeq YP_178014.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | galactofuranosyl transferase GlfT |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Galactofuranosyl transferase GlfT. Pfam: Glycos_transf_2 (PF00535.33). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WMX3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Galactofuranosyltransferase GlfT1 |
| EC (curated) |
EC 2.4.1.287
|
| Curated function | Involved in the biosynthesis of the arabinogalactan (AG) region of the mycolylarabinogalactan-peptidoglycan (mAGP) complex, an essential component of the mycobacterial cell wall. Catalyzes the transfer of the first two galactofuranosyl (Galf) units from UDP-galactofuranose (UDP-Galf) onto the rhamnosyl-GlcNAc-diphospho-decaprenol (Rha-GlcNAc-PP-C50) acceptor, yielding galactofuranosyl-galactofuranosyl-rhamnosyl-GlcNAc-diphospho-decaprenol (Galf-Galf-Rha-GlcNAc-PP-C50). Thus, GlfT1 is the initiator of galactan synthesis, while GlfT2 continues with the subsequent polymerization events. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | glfT1 |
| eggNOG description | PFAM Glycosyl transferase family 2 |
| Orthologous group | COG1216 |
| EC number |
EC 2.4.1.287
|
| KEGG orthology |
K16649
|
| CAZy family |
GT2
|
| Gene Ontology (35) |
GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0008152, GO:0008378, GO:0009058, GO:0009059, GO:0009987, GO:0016020 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.356 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glycos_transf_2 | PF00535.33 | 4.6e-07 | 8–116 | Glycosyl transferase family 2 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rfbD (O-antigen/lipopolysaccharide ABC transporter permease RfbD), high confidence from genomic context alone (score 994 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3783 rfbD |
O-antigen/lipopolysaccharide ABC transporter permease RfbD | 998 | 994 ctx | neighborhood:881 cooccurence:640 coexpression:876 textmining:815 |
Rv3808c glfT2 |
galactofuranosyl transferase GlfT | 998 | 980 ctx | cooccurence:770 database:900 textmining:934 |
Rv3781 rfbE |
O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE | 992 | 939 ctx | neighborhood:882 textmining:879 |
Rv3265c wbbL1 |
N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase | 962 | 920 | database:900 textmining:550 |
Rv3809c glf |
UDP-galactopyranose mutase | 962 | 901 ctx | cooccurence:744 database:500 textmining:637 |
Rv3780 bpa hyp |
hypothetical protein | 943 | 884 ctx | neighborhood:882 textmining:533 |
Rv3779 |
transmembrane protein | 908 | 881 ctx | neighborhood:881 |
Rv3311 hyp |
hypothetical protein | 733 | 733 ctx | cooccurence:731 |
Rv3212 hyp |
hypothetical protein | 700 | 701 ctx | cooccurence:683 |
Rv3839 hyp |
hypothetical protein | 665 | 666 ctx | cooccurence:664 |
Rv3778c |
aminotransferase | 638 | 638 ctx | neighborhood:636 |
Rv3004 cfp6 |
low molecular weight protein antigen 6 | 598 | 598 ctx | cooccurence:597 |
Rv3438 hyp |
hypothetical protein | 578 | 578 ctx | cooccurence:577 |
Rv2744c 35kd_ag hyp |
hypothetical protein | 573 | 574 ctx | cooccurence:571 |
Rv1083 hyp |
hypothetical protein | 548 | 548 ctx | cooccurence:548 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): galactofuranosyl transferase GlfT
- Pfam (hmmscan --cut_ga): Glycos_transf_2 PF00535.33 (E=5e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178014.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glycos_transf_2 (PF00535.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1216 - Curated reference: UniProt P9WMX3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
56 functional partner(s); context anchor
rfbD - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3782|glfT1 MTESVFAVVVTHRRPDELAKSLDVLTAQTRLPDHLIVVDNDGCGDSPVRELVAGQPIATTYLGSRRNLGGAGGFALGMLHALAQGADWVWLADDDGHAQDARVLATLLACAEKYSLAEVSPMVCNIDDPTRLAFPLRRGLVWRRRASELRTEAGQELLPGIASLFNGALFRASTLAAIGVPDLRLFIRGDEVEMHRRLIRSGLPFGTCLDAAYLHPCGSDEFKPILCGRMHAQYPDDPGKRFFTYRNRGYVLSQPGLRKLLAQEWLRFGWFFLVTRRDPKGLWEWIRLRRLGRREKFGKPGGSA