Rv3787c Resolved · high auto-curated
H37Rv Rv3787c · MTBC0 mtbc0_004015 ·
308 aa · 4257731–4258657 (-) ·
RefSeq NP_218304.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | S-adenosyl-L-methionine-dependent methyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | class I SAM-dependent methyltransferase |
| Revised (this work) | Class I SAM-dependent methyltransferase. Pfam: LCM (PF04072.21). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WFH3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative S-adenosyl-L-methionine-dependent methyltransferase Rv3787c |
| EC (curated) |
EC 2.1.1.-
|
| Curated function | Exhibits S-adenosyl-L-methionine-dependent methyltransferase activity. |
UniProt still lists this protein as Putative S-adenosyl-L-methionine-dependent methyltransferase Rv3787c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| eggNOG description | Exhibits S-adenosyl-L-methionine-dependent methyltransferase activity |
| Orthologous group | COG3315 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.708 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LCM | PF04072.21 | 2.9e-70 | 19–203 | Leucine carboxyl methyltransferase |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3786c hyp |
hypothetical protein | 865 | 865 ctx | neighborhood:864 |
Rv3788 hyp |
hypothetical protein | 492 | 491 ctx | neighborhood:488 |
Rv0645c mmaA1 |
mycolic acid methyltransferase MmaA1 | 547 | 44 | textmining:546 |
Rv3392c cmaA1 |
cyclopropane mycolic acid synthase CmaA | 630 | 42 | textmining:630 |
Rv0644c mmaA2 |
cyclopropane mycolic acid synthase CmaA | 437 | 41 | textmining:437 |
Rv0503c cmaA2 |
cyclopropane mycolic acid synthase | 433 | 41 | textmining:433 |
Rv0081 |
HTH-type transcriptional regulator | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: S-adenosyl-L-methionine-dependent methyltransferase
- MTBC0 PGAP product: class I SAM-dependent methyltransferase
- Pfam (hmmscan --cut_ga): LCM PF04072.21 (E=3e-70)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218304.1)
- Domains: Pfam-A via hmmscan --cut_ga — LCM (PF04072.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3315 - Curated reference: UniProt P9WFH3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004015|Rv3787c| MARTDDDSWDLATGVGATATLVAAGRARAARAAQPLIDDPFAEPLVRAVGVEFLTRWATGELDAADVDDPDAAWGLQRMTTELVVRTRYFDQFFLDAAAAGVRQAVILASGLDARGYRLPWPADTTVFEVDQPRVLEFKAQTLAGLGAQPTADLRMVPADLRHDWPDALRRGGFDAAEPAAWIAEGLFGYLPPDAQNRLLDHVTDLSAPGSRLALEAFLGSADRDSARVEEMIRTATRGWREHGFHLDIWALNYAGPRHEVSGYLDNHGWRSVGTTTAQLLAAHDLPAAPALPAGLADRPNYWTCVLG