Rv3789 Resolved · high auto-curated

H37Rv Rv3789 · MTBC0 mtbc0_004017 · 121 aa · 4259495–4259860 (+) · RefSeq NP_218306.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)GtrA family protein
MTBC0 PGAP re-annotationarabinogalactan biosynthesis protein
Revised (this work)Arabinogalactan biosynthesis protein. Pfam: GtrA_DPMS_TM (PF04138.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMS9 SwissProt · reviewed · Evidence at protein level
UniProt nameArabinogalactan biosynthesis recruiting protein Rv3789
Curated functionRequired for arabinosylation of arabinogalactan (AG), an essential component of the mycobacterial cell wall. Probably acts as an anchor protein recruiting AftA, the first arabinosyl transferase involved in AG biosynthesis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptioncapsule polysaccharide biosynthetic process
Orthologous groupCOG2246

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.175 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GtrA_DPMS_TMPF04138.21 2.3e-202–118 GtrA/DPMS, transmembrane domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dprE1 (decaprenylphosphoryl-beta-D-ribose oxidase), high confidence from genomic context alone (score 958 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3790 dprE1 decaprenylphosphoryl-beta-D-ribose oxidase 965 958 ctx neighborhood:823 cooccurence:762
Rv3791 dprE2 decaprenylphosphoryl-D-2-keto erythropentose reductase 966 957 ctx neighborhood:823 cooccurence:764
Rv3793 embC arabinosyltransferase C 964 949 ctx neighborhood:823 cooccurence:720
Rv3792 aftA arabinofuranosyltransferase 911 886 ctx neighborhood:823
Rv3794 embA arabinosyltransferase A 882 862 ctx neighborhood:527 cooccurence:711
Rv3795 embB arabinosyltransferase B 874 860 ctx neighborhood:503 cooccurence:726
Rv3788 hyp hypothetical protein 776 777 ctx neighborhood:768
Rv3806c ubiA decaprenyl-phosphate phosphoribosyltransferase 798 756 ctx cooccurence:742
Rv2073c oxidoreductase 735 736 ctx cooccurence:726
Rv0531 membrane protein 613 599 ctx cooccurence:596
Rv3438 hyp hypothetical protein 590 590 ctx cooccurence:579
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 635 562 ctx cooccurence:554
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 567 527 ctx cooccurence:503
Rv3311 hyp hypothetical protein 525 526 ctx cooccurence:522
Rv3802c membrane protein 513 514 ctx cooccurence:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: GtrA family protein
  • MTBC0 PGAP product: arabinogalactan biosynthesis protein
  • Pfam (hmmscan --cut_ga): GtrA_DPMS_TM PF04138.21 (E=2e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218306.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GtrA_DPMS_TM (PF04138.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2246
  • Curated reference: UniProt P9WMS9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor dprE1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004017|Rv3789|
MRFVVTGGLAGIVDFGLYVVLYKVAGLQVDLSKAISFIVGTITAYLINRRWTFQAEPSTARFVAVMLLYGITFAVQVGLNHLCLALLHYRAWAIPVAFVIAQGTATVINFIVQRAVIFRIR