prcB Family assigned · medium auto-curated

H37Rv Rv2110c · MTBC0 mtbc0_002242 · 291 aa · 2396989–2397864 (-) · RefSeq NP_216626.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)proteasome subunit beta
MTBC0 PGAP re-annotationproteasome subunit beta
Revised (this work)Proteasome subunit beta. Pfam: Proteasome (PF00227.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHT9 SwissProt · reviewed · Evidence at protein level
UniProt nameProteasome subunit beta
EC (curated) EC 3.4.25.1
Curated functionComponent of the proteasome core, a large protease complex with broad specificity involved in protein degradation. The M.tuberculosis proteasome is able to cleave oligopeptides not only after hydrophobic but also after basic, acidic and small neutral residues. In complex with the ATPase Mpa, degrades protein targets conjugated to a prokaryotic ubiquitin-like protein (Pup). Among the identified substrates of the M.tuberculosis proteasome are the pupylated FabD, PanB and Mpa proteins. One function of the proteasome is to contribute to M.tuberculosis ability to resist killing by host macrophages,.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameprcB
eggNOG descriptionComponent of the proteasome core, a large protease complex with broad specificity involved in protein degradation
Orthologous groupCOG0638
EC number EC 3.4.25.1
KEGG orthology K03433
KEGG pathways map03050
KEGG modules M00342, M00343
Gene Ontology (58) GO:0000502, GO:0003674, GO:0003824, GO:0004175, GO:0004298, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005622, GO:0005623, GO:0005839 +46 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.236 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ProteasomePF00227.32 5.6e-2956–240 Proteasome subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: prcA (proteasome subunit alpha), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2109c prcA proteasome subunit alpha 999 1000 ctx neighborhood:881 cooccurence:774 coexpression:751 experimental:999 database:900 textmining:948
Rv2111c pup ubiquitin-like protein Pup 999 997 ctx neighborhood:882 cooccurence:749 experimental:898 textmining:735
Rv2115c mpa proteasome-associated ATPase 998 993 ctx cooccurence:764 experimental:898 database:662 textmining:805
Rv3780 bpa hyp hypothetical protein 960 949 ctx cooccurence:754 experimental:800
Rv2112c dop pup deamidase/depupylase 978 937 ctx neighborhood:766 cooccurence:737 textmining:664
Rv1334 mec [CysO 937 929 experimental:786 database:662
Rv3696c glpK glycerol kinase 936 929 experimental:791 database:662
Rv2097c pafA proteasome accessory factor PafA 960 875 ctx neighborhood:539 cooccurence:734 textmining:696
Rv0435c ATPase 785 772 experimental:406 database:537
Rv3868 eccA1 ESX-1 secretion system protein EccA1 756 742 experimental:406 database:537
Rv0282 eccA3 ESX-3 secretion system protein EccA 755 741 experimental:406 database:537
Rv3884c eccA2 ESX-2 secretion system protein EccA 754 739 experimental:406 database:537
Rv2555c alaS alanine--tRNA ligase 648 649 database:601
Rv1223 htrA serine protease HtrA 691 628 database:562
Rv0983 pepD serine protease PepD 643 626 database:562

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: proteasome subunit beta
  • MTBC0 PGAP product: proteasome subunit beta
  • Pfam (hmmscan --cut_ga): Proteasome PF00227.32 (E=6e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216626.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Proteasome (PF00227.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0638
  • Curated reference: UniProt P9WHT9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor prcA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002242|Rv2110c|prcB
MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPLLAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGGPDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK