espG1 Resolved · high auto-curated

H37Rv Rv3866 · MTBC0 mtbc0_004099 · 283 aa · 4366037–4366888 (+) · RefSeq NP_218383.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 secretion-associated protein EspG
MTBC0 PGAP re-annotationtype VII secretion system ESX-1 adaptor EspG1
Revised (this work)Type VII secretion system ESX-1 adaptor EspG1. Pfam: ESX-1_EspG (PF14011.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96210 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-1 secretion-associated protein EspG1
Curated functionSpecific chaperone for cognate PE/PPE proteins. Plays an important role in preventing aggregation of PE/PPE dimers.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameespG1
eggNOG descriptionSpecific chaperone for cognate PE PPE proteins. Plays an important role in preventing aggregation of PE PPE dimers
Orthologous group290YB
Gene Ontology (13) GO:0001666, GO:0005575, GO:0005623, GO:0005886, GO:0006950, GO:0008150, GO:0009628, GO:0016020, GO:0036293, GO:0044464, GO:0050896, GO:0070482 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.722 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ESX-1_EspGPF14011.12 2.0e-5322–258 EspG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccA1 (ESX-1 secretion system protein EccA1), high confidence from genomic context alone (score 936 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3868 eccA1 ESX-1 secretion system protein EccA1 973 936 ctx neighborhood:825 coexpression:651 textmining:609
Rv3873 PPE68 PPE family protein PPE68 957 935 ctx neighborhood:571 coexpression:855
Rv3864 espE ESX-1 secretion-associated protein EspE 946 935 ctx neighborhood:594 coexpression:846
Rv3865 espF ESX-1 secretion-associated protein EspF 937 886 ctx neighborhood:881 textmining:469
Rv3867 espH ESX-1 secretion-associated protein EspH 914 854 ctx neighborhood:687 coexpression:553 textmining:436
Rv3870 eccCa1 ESX-1 secretion system protein EccCa 885 832 ctx neighborhood:825
Rv3869 eccB1 ESX-1 secretion system protein EccB 924 831 ctx neighborhood:825 textmining:569
Rv3871 eccCb1 ESX-1 secretion system protein EccCb 810 744 ctx neighborhood:736
Rv3876 espI ESX-1 secretion-associated protein EspI 703 500 coexpression:404 textmining:431
Rv0757 phoP two component system response transcriptional positive regulator PhoP 516 458 coexpression:458
Rv3863 hyp hypothetical protein 482 456 ctx neighborhood:444
Rv3881c espB ESX-1 secretion-associated protein EspB 711 441 coexpression:441 textmining:505
Rv3874 esxB ESAT-6-like protein EsxB 685 372 textmining:519
Rv3878 espJ ESX-1 secretion-associated protein EspJ 536 366
Rv3875 esxA ESAT-6 protein EsxA 737 333 textmining:622

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 secretion-associated protein EspG
  • MTBC0 PGAP product: type VII secretion system ESX-1 adaptor EspG1
  • Pfam (hmmscan --cut_ga): ESX-1_EspG PF14011.12 (E=2e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218383.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ESX-1_EspG (PF14011.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 290YB
  • Curated reference: UniProt P96210 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor eccA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004099|Rv3866|espG1
MTGPSAAGRAGTADNVVGVEVTIDGMLVIADRLHLVDFPVTLGIRPNIPQEDLRDIVWEQVQRDLTAQGVLDLHGEPQPTVAEMVETLGRPDRTLEGRWWRRDIGGVMVRFVVCRRGDRHVIAARDGDMLVLQLVAPQVGLAGMVTAVLGPAEPANVEPLTGVATELAECTTASQLTQYGIAPASARVYAEIVGNPTGWVEIVASQRHPGGTTTQTDAAAGVLDSKLGRLVSLPRRVGGDLYGSFLPGTQQNLERALDGLLELLPAGAWLDHTSDHAQASSRG