espG1 Resolved · high auto-curated
H37Rv Rv3866 · MTBC0 mtbc0_004099 ·
283 aa · 4366037–4366888 (+) ·
RefSeq NP_218383.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESX-1 secretion-associated protein EspG |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system ESX-1 adaptor EspG1 |
| Revised (this work) | Type VII secretion system ESX-1 adaptor EspG1. Pfam: ESX-1_EspG (PF14011.12). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P96210
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESX-1 secretion-associated protein EspG1 |
| Curated function | Specific chaperone for cognate PE/PPE proteins. Plays an important role in preventing aggregation of PE/PPE dimers. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | espG1 |
| eggNOG description | Specific chaperone for cognate PE PPE proteins. Plays an important role in preventing aggregation of PE PPE dimers |
| Orthologous group | 290YB |
| Gene Ontology (13) |
GO:0001666, GO:0005575, GO:0005623, GO:0005886, GO:0006950, GO:0008150, GO:0009628, GO:0016020, GO:0036293, GO:0044464, GO:0050896, GO:0070482 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.722 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ESX-1_EspG | PF14011.12 | 2.0e-53 | 22–258 | EspG family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: eccA1 (ESX-1 secretion system protein EccA1), high confidence from genomic context alone (score 936 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3868 eccA1 |
ESX-1 secretion system protein EccA1 | 973 | 936 ctx | neighborhood:825 coexpression:651 textmining:609 |
Rv3873 PPE68 |
PPE family protein PPE68 | 957 | 935 ctx | neighborhood:571 coexpression:855 |
Rv3864 espE |
ESX-1 secretion-associated protein EspE | 946 | 935 ctx | neighborhood:594 coexpression:846 |
Rv3865 espF |
ESX-1 secretion-associated protein EspF | 937 | 886 ctx | neighborhood:881 textmining:469 |
Rv3867 espH |
ESX-1 secretion-associated protein EspH | 914 | 854 ctx | neighborhood:687 coexpression:553 textmining:436 |
Rv3870 eccCa1 |
ESX-1 secretion system protein EccCa | 885 | 832 ctx | neighborhood:825 |
Rv3869 eccB1 |
ESX-1 secretion system protein EccB | 924 | 831 ctx | neighborhood:825 textmining:569 |
Rv3871 eccCb1 |
ESX-1 secretion system protein EccCb | 810 | 744 ctx | neighborhood:736 |
Rv3876 espI |
ESX-1 secretion-associated protein EspI | 703 | 500 | coexpression:404 textmining:431 |
Rv0757 phoP |
two component system response transcriptional positive regulator PhoP | 516 | 458 | coexpression:458 |
Rv3863 hyp |
hypothetical protein | 482 | 456 ctx | neighborhood:444 |
Rv3881c espB |
ESX-1 secretion-associated protein EspB | 711 | 441 | coexpression:441 textmining:505 |
Rv3874 esxB |
ESAT-6-like protein EsxB | 685 | 372 | textmining:519 |
Rv3878 espJ |
ESX-1 secretion-associated protein EspJ | 536 | 366 | |
Rv3875 esxA |
ESAT-6 protein EsxA | 737 | 333 | textmining:622 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESX-1 secretion-associated protein EspG
- MTBC0 PGAP product: type VII secretion system ESX-1 adaptor EspG1
- Pfam (hmmscan --cut_ga): ESX-1_EspG PF14011.12 (E=2e-53)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218383.1)
- Domains: Pfam-A via hmmscan --cut_ga — ESX-1_EspG (PF14011.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
290YB - Curated reference: UniProt P96210 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
eccA1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004099|Rv3866|espG1 MTGPSAAGRAGTADNVVGVEVTIDGMLVIADRLHLVDFPVTLGIRPNIPQEDLRDIVWEQVQRDLTAQGVLDLHGEPQPTVAEMVETLGRPDRTLEGRWWRRDIGGVMVRFVVCRRGDRHVIAARDGDMLVLQLVAPQVGLAGMVTAVLGPAEPANVEPLTGVATELAECTTASQLTQYGIAPASARVYAEIVGNPTGWVEIVASQRHPGGTTTQTDAAAGVLDSKLGRLVSLPRRVGGDLYGSFLPGTQQNLERALDGLLELLPAGAWLDHTSDHAQASSRG