Rv3705c Family assigned · medium auto-curated

H37Rv Rv3705c · MTBC0 mtbc0_003927 · 214 aa · 4172266–4172910 (-) · RefSeq NP_218222.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationsensor domain-containing protein
Revised (this work)Sensor domain-containing protein. Pfam: PknH_C (PF14032.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XI06 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPknH-like extracellular domain
Orthologous group2C8AX

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.573 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PknH_CPF14032.13 2.6e-4829–211 PknH-like extracellular domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gshA (glutamate--cysteine ligase), medium confidence from genomic context alone (score 576 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3704c gshA glutamate--cysteine ligase 576 576 ctx neighborhood:556
Rv3702c egtC amidohydrolase EgtC 575 575 ctx neighborhood:555
Rv3701c egtD histidine-specific methyltransferase EtgD 561 561 ctx neighborhood:555
Rv3700c egtE pyridoxal-phosphate-dependent protein EgtE 560 560 ctx neighborhood:553
Rv3703c etgB iron(II)-dependent oxidoreductase EgtB 557 557 ctx neighborhood:543
Rv3705A hyp hypothetical protein 536 536 ctx neighborhood:531
Rv3706c hyp hypothetical protein 434 433 ctx neighborhood:430
Rv2253 hyp hypothetical protein 871 53 textmining:870
Rv0835 lpqQ lipoprotein LpqQ 810 47 textmining:809
Rv1352 hyp hypothetical protein 808 47 textmining:807
Rv1810 hyp hypothetical protein 518 47 textmining:515
Rv0063 oxidoreductase 870 44 textmining:870
Rv1418 lprH lipoprotein LprH 870 44 textmining:870
Rv3576 lppH lipoprotein LppH 680 44 textmining:679
Rv3016 lpqA lipoprotein LpqA 870 42 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: sensor domain-containing protein
  • Pfam (hmmscan --cut_ga): PknH_C PF14032.13 (E=3e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218222.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PknH_C (PF14032.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C8AX
  • Curated reference: UniProt I6XI06 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor gshA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003927|Rv3705c|
MRIAAAVVSIGLAVIAGFAVPVADAHPSEPGVVSYAVLGKGSVGNIVGAPMGWEAVFTRPFQAFWVELPACNNWVDIGLPEVYDDPDLASFNGATTQTSATDQTHLVKQAVGVFASNDAADRAFHRVVDRTVGCSGQTTAIHLDDGTTQVWSFAGGPSTGTDEAWTKQEAGTDRRCFVQTRLRENVLLQAKVCQSGNAGPAVNVLAGAMQNTLG