recR Resolved · high auto-curated

H37Rv Rv3715c · MTBC0 mtbc0_003938 · 203 aa · 4184010–4184621 (-) · RefSeq NP_218232.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)recombination protein RecR
MTBC0 PGAP re-annotationrecombination mediator RecR
Revised (this work)Recombination mediator RecR. Pfam: RecR_HhH (PF21176.4), RecR_ZnF (PF02132.22), Toprim_4 (PF13662.13), Toprim (PF01751.29), RecR_C (PF21175.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHI3 SwissProt · reviewed · Evidence at protein level
UniProt nameRecombination protein RecR
Curated functionMay play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namerecR
eggNOG descriptionMay play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO
Orthologous groupCOG0353
KEGG orthology K06187
KEGG pathways map03440

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.362 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RecR_HhHPF21176.4 1.8e-166–48 RecR, helix-hairpin-helix
RecR_ZnFPF02132.22 2.2e-0853–73 RecR, Cys4-zinc finger domain
Toprim_4PF13662.13 1.1e-2379–175 Toprim domain
ToprimPF01751.29 1.3e-1381–165 Toprim domain
RecR_CPF21175.3 5.6e-12177–200 RecR, C-terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: uvrD1 (ATP-dependent DNA helicase UvrD), medium confidence from genomic context alone (score 661 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3716c hyp hypothetical protein 983 973 ctx neighborhood:876 coexpression:792
Rv2362c recO DNA repair protein RecO 984 940 experimental:912 textmining:746
Rv3717 hyp hypothetical protein 873 774 ctx neighborhood:772 textmining:465
Rv3880c espL ESX-1 secretion-associated protein EspL 776 748 coexpression:734
Rv0949 uvrD1 ATP-dependent DNA helicase UvrD 761 661 ctx cooccurence:650
Rv3714c hyp hypothetical protein 635 636 ctx neighborhood:632
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 628 615
Rv3721c dnaZX DNA polymerase III subunit gamma/tau 652 605 coexpression:435
Rv2524c fas fatty acid synthase 587 587 ctx neighborhood:544
Rv2442c rplU 50S ribosomal protein L21 624 580 coexpression:484
Rv2154c ftsW lipid II flippase FtsW 615 578
Rv0639 nusG transcription termination/antitermination protein NusG 596 571 ctx cooccurence:471
Rv0002 dnaN DNA polymerase III subunit beta 639 520 ctx cooccurence:479
Rv0017c rodA cell division protein RodA 532 486
Rv3100c smpB SsrA-binding protein 510 479 ctx cooccurence:419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: recombination protein RecR
  • MTBC0 PGAP product: recombination mediator RecR
  • Pfam (hmmscan --cut_ga): RecR_HhH PF21176.4 (E=2e-16), RecR_ZnF PF02132.22 (E=2e-08), Toprim_4 PF13662.13 (E=1e-23), Toprim PF01751.29 (E=1e-13), RecR_C PF21175.3 (E=6e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218232.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RecR_HhH (PF21176.4), RecR_ZnF (PF02132.22), Toprim_4 (PF13662.13), Toprim (PF01751.29), RecR_C (PF21175.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0353
  • Curated reference: UniProt P9WHI3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 71 functional partner(s); context anchor uvrD1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003938|Rv3715c|recR
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA