recR Resolved · high auto-curated
H37Rv Rv3715c · MTBC0 mtbc0_003938 ·
203 aa ·
4184010–4184621 MTBC0
(-) ·
RefSeq NP_218232.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | recombination protein RecR |
|---|---|
| MTBC0 PGAP re-annotation | recombination mediator RecR |
| Revised (this work) | Recombination mediator RecR. Pfam: RecR_HhH (PF21176.4), RecR_ZnF (PF02132.22), Toprim_4 (PF13662.13), Toprim (PF01751.29), RecR_C (PF21175.3). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Antibiotic Resistome Alteration by Different Disinfection Strategies in a Full-Scale Drinking Water Treatment Plant Deciphered by Metagenomic Assembly. doi:10.1021/acs.est.8b05907 | 2019 |
| Homologous recombination mediated by the mycobacterial AdnAB helicase without end resection by the AdnAB nucleases. doi:10.1093/nar/gkw1130 | 2017 |
| A comparative analysis of the DNA recombination repair pathway in mycobacterial genomes. doi:10.1016/j.tube.2016.04.011 | 2016 |
| RecF and RecR Play Critical Roles in the Homologous Recombination and Single-Strand Annealing Pathways of Mycobacteria. doi:10.1128/JB.00290-15 | 2015 |
| Resolving lineage assignation on Mycobacterium tuberculosis clinical isolates classified by spoligotyping with a new high-throughput 3R SNPs based method. doi:10.1016/j.meegid.2010.07.006 | 2010 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -1.20 (95% CI -2.69 to 1.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | May play a role in DNA repair. It seems to be involved in an RECBC-independent recombinational process of DNA repair. It may act with RECF|Rv0003 (and RECO|Rv2362c ?) for modulating assembly of disassembly of RECA filaments. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3742c
· 100.0% identity |
|---|---|
| M. leprae |
ML2329c
· 91.1% identity |
| M. marinum |
MMAR_5231
· 91.6% identity |
| M. smegmatis |
MSMEG_6279
· 90.6% identity |
| M. orygis |
RJtmp_003819
· 100.0% identity |
| M. abscessus |
MAB_0320
· 84.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHI3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Recombination protein RecR |
| Curated function | May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | recR |
| eggNOG description | May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO |
| Orthologous group | COG0353 |
| KEGG orthology |
K06187
|
| KEGG pathways |
map03440
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.362 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 92.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.4% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 67.75. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +4.06 | 0.035 | disruption advantageous |
| fitness after prolonged in vitro passage (in vitro passage) | -3.48 | 0.049 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 72.3 ppm · rank 1506/3519 (57.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 203 aa |
|---|---|
| Molecular weight | 22.1 kDa |
| Theoretical pI | 4.99 |
| GRAVY | -0.058 (hydrophilic) |
| Aliphatic index | 105.6 |
| Aromaticity | 0.034 |
| Instability index | 20.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RecR_HhH | PF21176.4 | 1.8e-16 | 6–48 | RecR, helix-hairpin-helix |
RecR_ZnF | PF02132.22 | 2.2e-08 | 53–73 | RecR, Cys4-zinc finger domain |
Toprim_4 | PF13662.13 | 1.1e-23 | 79–175 | Toprim domain |
Toprim | PF01751.29 | 1.3e-13 | 81–165 | Toprim domain |
RecR_C | PF21175.3 | 5.6e-12 | 177–200 | RecR, C-terminal |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3vdp-assembly2_C |
1.00 | 0.95 | 6.4e-26 sig | 3vdp-assembly2_C Structure and biochemical studies of the recombination mediator protein RecR in RecFOR pathway |
1vdd-assembly1_A |
1.00 | 0.94 | 5.2e-24 sig | 1vdd-assembly1_A Crystal structure of recombinational repair protein RecR |
5zvq-assembly1_A-2 |
1.00 | 0.96 | 3.0e-23 sig | 5zvq-assembly1_A-2 Crystal structure of recombination mediator protein RecR |
4jcv-assembly1_D |
1.00 | 0.94 | 2.2e-23 sig | 4jcv-assembly1_D Crystal structure of the RecOR complex in an open conformation |
4o6o-assembly1_B |
1.00 | 0.83 | 3.5e-24 sig | 4o6o-assembly1_B Structural and functional studies the characterization of Cys4 Zinc-finger motif in the recombination mediator protein RecR |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv3714c (- strand, 67 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3716c (- strand, 11 bp gap) |
| Predicted operon |
recR · Rv3716c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
whiA (represses) · espR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: uvrD1 (ATP-dependent DNA helicase UvrD), medium confidence from genomic context alone (score 661 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3716c hyp |
hypothetical protein | 983 | 973 ctx | neighborhood:876 coexpression:792 |
Rv2362c recO exp |
DNA repair protein RecO | 984 | 940 | experimental:912 textmining:746 |
Rv3717 hyp |
hypothetical protein | 873 | 774 ctx | neighborhood:772 textmining:465 |
Rv3880c espL |
ESX-1 secretion-associated protein EspL | 776 | 748 | coexpression:734 |
Rv0949 uvrD1 |
ATP-dependent DNA helicase UvrD | 761 | 661 ctx | cooccurence:650 |
Rv3714c hyp |
hypothetical protein | 635 | 636 ctx | neighborhood:632 |
Rv2455c korA |
2-oxoglutarate oxidoreductase subunit KorA | 628 | 615 | |
Rv3721c dnaZX |
DNA polymerase III subunit gamma/tau | 652 | 605 | coexpression:435 |
Rv2524c fas |
fatty acid synthase | 587 | 587 ctx | neighborhood:544 |
Rv2442c rplU |
50S ribosomal protein L21 | 624 | 580 | coexpression:484 |
Rv2154c ftsW |
lipid II flippase FtsW | 615 | 578 | |
Rv0639 nusG |
transcription termination/antitermination protein NusG | 596 | 571 ctx | cooccurence:471 |
Rv0002 dnaN |
DNA polymerase III subunit beta | 639 | 520 ctx | cooccurence:479 |
Rv0017c rodA |
cell division protein RodA | 532 | 486 | |
Rv3100c smpB |
SsrA-binding protein | 510 | 479 ctx | cooccurence:419 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: recombination protein RecR
- MTBC0 PGAP product: recombination mediator RecR
- Pfam (hmmscan --cut_ga): RecR_HhH PF21176.4 (E=2e-16), RecR_ZnF PF02132.22 (E=2e-08), Toprim_4 PF13662.13 (E=1e-23), Toprim PF01751.29 (E=1e-13), RecR_C PF21175.3 (E=6e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218232.1)
- Domains: Pfam-A via hmmscan --cut_ga — RecR_HhH (PF21176.4), RecR_ZnF (PF02132.22), Toprim_4 (PF13662.13), Toprim (PF01751.29), RecR_C (PF21175.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0353 - Curated reference: UniProt P9WHI3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
71 functional partner(s); context anchor
uvrD1 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003938|Rv3715c|recR MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for recR? Email the maintainer — the message is pre-filled with this gene's details.