recR Resolved · high auto-curated

H37Rv Rv3715c · MTBC0 mtbc0_003938 · 203 aa · 4184010–4184621 MTBC0 (-) · RefSeq NP_218232.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)recombination protein RecR
MTBC0 PGAP re-annotationrecombination mediator RecR
Revised (this work)Recombination mediator RecR. Pfam: RecR_HhH (PF21176.4), RecR_ZnF (PF02132.22), Toprim_4 (PF13662.13), Toprim (PF01751.29), RecR_C (PF21175.3).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 6 publications

6 TB publications mention this gene. 6 publication(s) discuss this gene (2 in a M. tuberculosis context).

Most recent 5 of 6.
PublicationDate
Antibiotic Resistome Alteration by Different Disinfection Strategies in a Full-Scale Drinking Water Treatment Plant Deciphered by Metagenomic Assembly. doi:10.1021/acs.est.8b05907 2019
Homologous recombination mediated by the mycobacterial AdnAB helicase without end resection by the AdnAB nucleases. doi:10.1093/nar/gkw1130 2017
A comparative analysis of the DNA recombination repair pathway in mycobacterial genomes. doi:10.1016/j.tube.2016.04.011 2016
RecF and RecR Play Critical Roles in the Homologous Recombination and Single-Strand Annealing Pathways of Mycobacteria. doi:10.1128/JB.00290-15 2015
Resolving lineage assignation on Mycobacterium tuberculosis clinical isolates classified by spoligotyping with a new high-throughput 3R SNPs based method. doi:10.1016/j.meegid.2010.07.006 2010

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -1.20 (95% CI -2.69 to 1.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionMay play a role in DNA repair. It seems to be involved in an RECBC-independent recombinational process of DNA repair. It may act with RECF|Rv0003 (and RECO|Rv2362c ?) for modulating assembly of disassembly of RECA filaments.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3742c · 100.0% identity
M. leprae ML2329c · 91.1% identity
M. marinum MMAR_5231 · 91.6% identity
M. smegmatis MSMEG_6279 · 90.6% identity
M. orygis RJtmp_003819 · 100.0% identity
M. abscessus MAB_0320 · 84.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WHI3 SwissProt · reviewed · Evidence at protein level
UniProt nameRecombination protein RecR
Curated functionMay play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namerecR
eggNOG descriptionMay play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO
Orthologous groupCOG0353
KEGG orthology K06187
KEGG pathways map03440

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.362 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 92.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.4%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 67.75. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatStatistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) +4.060.035 disruption advantageous
fitness after prolonged in vitro passage (in vitro passage) -3.480.049 required

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance72.3 ppm · rank 1506/3519 (57.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length203 aa
Molecular weight22.1 kDa
Theoretical pI4.99
GRAVY-0.058 (hydrophilic)
Aliphatic index105.6
Aromaticity0.034
Instability index20.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RecR_HhHPF21176.4 1.8e-166–48 RecR, helix-hairpin-helix
RecR_ZnFPF02132.22 2.2e-0853–73 RecR, Cys4-zinc finger domain
Toprim_4PF13662.13 1.1e-2379–175 Toprim domain
ToprimPF01751.29 1.3e-1381–165 Toprim domain
RecR_CPF21175.3 5.6e-12177–200 RecR, C-terminal

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.3

PDB hitprobTM-scoreE-valueDescription
3vdp-assembly2_C 1.00 0.95 6.4e-26 sig 3vdp-assembly2_C Structure and biochemical studies of the recombination mediator protein RecR in RecFOR pathway
1vdd-assembly1_A 1.00 0.94 5.2e-24 sig 1vdd-assembly1_A Crystal structure of recombinational repair protein RecR
5zvq-assembly1_A-2 1.00 0.96 3.0e-23 sig 5zvq-assembly1_A-2 Crystal structure of recombination mediator protein RecR
4jcv-assembly1_D 1.00 0.94 2.2e-23 sig 4jcv-assembly1_D Crystal structure of the RecOR complex in an open conformation
4o6o-assembly1_B 1.00 0.83 3.5e-24 sig 4o6o-assembly1_B Structural and functional studies the characterization of Cys4 Zinc-finger motif in the recombination mediator protein RecR

Foldseek search of the AlphaFold DB model (mean pLDDT 94.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv3714c (- strand, 67 bp gap)
Downstream (3' on genome)Rv3716c (- strand, 11 bp gap)
Predicted operon recR · Rv3716c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) whiA (represses) · espR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: uvrD1 (ATP-dependent DNA helicase UvrD), medium confidence from genomic context alone (score 661 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3716c hyp hypothetical protein 983 973 ctx neighborhood:876 coexpression:792
Rv2362c recO exp DNA repair protein RecO 984 940 experimental:912 textmining:746
Rv3717 hyp hypothetical protein 873 774 ctx neighborhood:772 textmining:465
Rv3880c espL ESX-1 secretion-associated protein EspL 776 748 coexpression:734
Rv0949 uvrD1 ATP-dependent DNA helicase UvrD 761 661 ctx cooccurence:650
Rv3714c hyp hypothetical protein 635 636 ctx neighborhood:632
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 628 615
Rv3721c dnaZX DNA polymerase III subunit gamma/tau 652 605 coexpression:435
Rv2524c fas fatty acid synthase 587 587 ctx neighborhood:544
Rv2442c rplU 50S ribosomal protein L21 624 580 coexpression:484
Rv2154c ftsW lipid II flippase FtsW 615 578
Rv0639 nusG transcription termination/antitermination protein NusG 596 571 ctx cooccurence:471
Rv0002 dnaN DNA polymerase III subunit beta 639 520 ctx cooccurence:479
Rv0017c rodA cell division protein RodA 532 486
Rv3100c smpB SsrA-binding protein 510 479 ctx cooccurence:419

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: recombination protein RecR
  • MTBC0 PGAP product: recombination mediator RecR
  • Pfam (hmmscan --cut_ga): RecR_HhH PF21176.4 (E=2e-16), RecR_ZnF PF02132.22 (E=2e-08), Toprim_4 PF13662.13 (E=1e-23), Toprim PF01751.29 (E=1e-13), RecR_C PF21175.3 (E=6e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218232.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RecR_HhH (PF21176.4), RecR_ZnF (PF02132.22), Toprim_4 (PF13662.13), Toprim (PF01751.29), RecR_C (PF21175.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0353
  • Curated reference: UniProt P9WHI3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 71 functional partner(s); context anchor uvrD1
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003938|Rv3715c|recR
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA