Rv2253 Family assigned · medium

H37Rv Rv2253 · MTBC0 mtbc0_002395 · 167 aa · 2554144–2554647 (+) · RefSeq NP_216769.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Membrane protein with a PknI-sensor-domain-like extracytoplasmic sensor fold; distinct from PknI/Rv2914c (fold-paralogue safeguard). Same sensor fold as Rv3491.

Curated reference (UniProt)

UniProt O53527 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSecreted protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BFCU

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 84.5 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5xlm-assembly1_A 1.00 0.69 4.7e-07 sig 5xlm-assembly1_A Monomer form of M.tuberculosis PknI sensor domain
5xlm-assembly2_B 1.00 0.63 2.0e-06 sig 5xlm-assembly2_B Monomer form of M.tuberculosis PknI sensor domain
5xll-assembly1_A 1.00 0.64 5.5e-05 sig 5xll-assembly1_A Dimer form of M. tuberculosis PknI sensor domain
2cwz-assembly2_D 0.21 0.42 4.4e-01 2cwz-assembly2_D Crystal structure of the Thermus thermophilus hypothetical protein TTHA0967, a thioesterase superfamily member
2m07-assembly1_A 0.21 0.35 5.5e-01 2m07-assembly1_A NMR structure of OmpX in DPC micelles
5vj8-assembly1_A 0.21 0.34 4.6e-01 5vj8-assembly1_A Backbone structure of the Yersinia pestis outer membrane protein Ail in phospholipid bilayer nanodisc
1q9g-assembly1_A 0.20 0.32 2.2e-01 1q9g-assembly1_A NMR STRUCTURE OF THE OUTER MEMBRANE PROTEIN OMPX IN DHPC MICELLES
5hqw-assembly1_A 0.16 0.35 3.0e-01 5hqw-assembly1_A Crystal structure of a trans-AT PKS dehydratase domain of C0ZGQ6 from Brevibacillus brevis

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dagK (diacylglycerol kinase), high confidence from genomic context alone (score 799 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2252 dagK diacylglycerol kinase 799 799 ctx neighborhood:796
Rv2249c glpD1 glycerol-3-phosphate dehydrogenase 711 711 ctx neighborhood:710
Rv2251 flavoprotein 613 614 ctx neighborhood:611
Rv2250A Possible flavoprotein; Rv2250A, len: 139 aa. Conserved hypothetical protein, possibly flavoprotein. Similar to N-terminus of SCF91.28c|AL132 613 613 ctx neighborhood:611
Rv2250c HTH-type transcriptional regulator 596 597 ctx neighborhood:594
Rv0063 oxidoreductase 871 55 textmining:870
Rv3705c hyp hypothetical protein 871 53 textmining:870
Rv1804c hyp hypothetical protein 870 47 textmining:870
Rv0603 hyp hypothetical protein 870 47 textmining:870
Rv0519c membrane protein 811 47 textmining:810
Rv1810 hyp hypothetical protein 514 47 textmining:511
Rv2903c lepB signal peptidase 809 45 textmining:809
Rv0203 hyp hypothetical protein 543 44 textmining:542
Rv1271c hyp hypothetical protein 870 41 textmining:870
Rv1352 hyp hypothetical protein 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: PknI sensor domain, TM 0.64, E 1e-9 (PknI = Rv2914c, not this locus)
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216769.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BFCU
  • Curated reference: UniProt O53527 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 84.5, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor dagK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002395|Rv2253|
MSGHRKKAMLALAAASLAATLAPNAVAAAEPSWNGQYLVTLSANAKTGTSMAANRPEYPHKANYTFSSRCASDVCIATVVDAPPPKNEFIPRPIEYTWNGTQWVREISWQWDCLLPDGTIEYAPAKSITAYTPGQYGILTGVFHTDIASGTCKGNVDMPVSAKPIVG