Rv3705A Family assigned · medium

H37Rv Rv3705A · MTBC0 - · 129 aa · 4149091–4149480 (-) · RefSeq YP_178006.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Effector of the TcrXY acid-sensing two-component system regulon, required for persistent infection. RefSeq leaves it of unknown function. Rv3705A is one of two characterised members of the ~70-gene TcrXY regulon implicated as a key determinant of Mtb survival in vivo by mitigating redox stress at acidic pH (Stupar 2024). Molecular function unfixed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6YGY9 TrEMBL · unreviewed · Predicted
UniProt nameConserved hypothetical proline rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BJN6

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.753 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3706c hyp hypothetical protein 644 645 ctx neighborhood:555
Rv3705c hyp hypothetical protein 536 536 ctx neighborhood:531

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • TcrXY two-component regulon effector; redox-stress survival at acidic pH (Stupar 2024, PMID 38388565)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178006.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BJN6
  • Curated reference: UniProt I6YGY9 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 82.2, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s)
  • Primary literature: Stupar M, Tan L, Kerr ED, De Voss CJ, Forde BM, Schulz BL, West NP (2024). TcrXY is an acid-sensing two-component transcriptional regulator of Mycobacterium tuberculosis required for persistent infection Nat Commun 15(1):1615. doi:10.1038/s41467-024-45343-7 PMID:38388565

Ancestral MTBC0 protein sequence

>H37Rv|Rv3705A|
MTETPQPAAPPPSAATTSPPPSPQQEKPPRLYRAAAWVVIVAGIVFTVAVIFFSGALVLGQGKCPYHRYYHHGMFRPVGPVAPGPGMGWVFGFPGGPPPPGMGPGFPGGPGGPAVGPTGPGPTTAPARP