Rv3699 Resolved · high auto-curated

H37Rv Rv3699 · MTBC0 mtbc0_003921 · 233 aa · 4165992–4166693 MTBC0 (+) · RefSeq NP_218216.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationclass I SAM-dependent methyltransferase
Revised (this work)Class I SAM-dependent methyltransferase. Pfam: TPMT (PF05724.18), Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 3 publications

Found under: H37Rv (3).

3 TB publications mention this gene. 3 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Recognition of specific immunogenic antigens with potential diagnostic value in multi-drug resistant Mycobacterium tuberculosis inducing humoral immunity in MDR-TB patients. doi:10.1016/j.meegid.2022.105328 2022
Comparing mRNA expression and protein abundance in MDR Mycobacterium tuberculosis: Novel protein candidates, Rv0443, Rv0379 and Rv0147 as TB potential diagnostic or therapeutic targets. doi:10.1016/j.btre.2021.e00641 2021
Proteomic analysis of drug-resistant Mycobacterium tuberculosis by one-dimensional gel electrophoresis and charge chromatography. doi:10.1007/s00203-016-1267-8 2017

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.14 (95% CI -0.46 to 3.97). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3725 · 100.0% identity
M. marinum MMAR_5210 · 82.8% identity
M. smegmatis MSMEG_6235 · 69.3% identity
M. orygis RJtmp_003802 · 100.0% identity
M. abscessus MAB_0961c · 59.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O69667 TrEMBL · unreviewed · Evidence at protein level
UniProt name2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase
EC (curated) EC 2.1.1.374

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionMethyltransferase
Orthologous groupCOG0500

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 74.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 2/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 60.7%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 118.538461538. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance1036.0 ppm · rank 220/3519 (93.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length233 aa
Molecular weight25.0 kDa
Theoretical pI4.69
GRAVY-0.096 (hydrophilic)
Aliphatic index83.0
Aromaticity0.099
Instability index36.1 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TPMTPF05724.18 1.2e-1322–186 Thiopurine S-methyltransferase (TPMT)
Methyltransf_23PF13489.13 2.2e-0831–154 Methyltransferase domain
Methyltransf_31PF13847.13 3.1e-1345–169 Methyltransferase domain
Methyltransf_25PF13649.13 1.8e-1546–144 Methyltransferase domain
Methyltransf_11PF08241.19 4.0e-1247–148 Methyltransferase domain
Methyltransf_12PF08242.19 2.5e-1047–145 Methyltransferase domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.5

PDB hitprobTM-scoreE-valueDescription
7ndm-assembly1_A 1.00 0.90 2.1e-27 sig 7ndm-assembly1_A Crystal structure of the heterocyclic toxin methyltransferase from Mycobacterium tuberculosis with bound substrate 4-hydroxyisoquinolin-1(2H)-one
7nmk-assembly1_A 1.00 0.90 5.0e-27 sig 7nmk-assembly1_A Crystal structure of the heterocyclic toxin methyltransferase from Mycobacterium tuberculosis with bound methylation product 1-methoxyquinolin-4(1H)-one
7bgg-assembly1_A 1.00 0.89 7.8e-27 sig 7bgg-assembly1_A Crystal structure of the heterocyclic toxin methyltransferase from Mycobacterium tuberculosis
7noy-assembly1_A 1.00 0.89 4.2e-26 sig 7noy-assembly1_A Crystal structure of the heterocyclic toxin methyltransferase from Mycobacterium tuberculosis in complex with substrate 1-hydroxyquinolin-4(1H)-one
4nec-assembly4_D 1.00 0.77 1.4e-21 sig 4nec-assembly4_D Conversion of a Disulfide Bond into a Thioacetal Group during Echinomycin Biosynthesis

Foldseek search of the AlphaFold DB model (mean pLDDT 91.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv3698 (+ strand, 21 bp gap)
Downstream (3' on genome)egtE (- strand, 2 bp gap)
Predicted operon Rv3698 · Rv3699

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: eccD3 (ESX-3 secretion system protein EccD), medium confidence from genomic context alone (score 546 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3698 hyp hypothetical protein 717 716 ctx neighborhood:715
Rv0290 eccD3 ESX-3 secretion system protein EccD 545 546 ctx cooccurence:543
Rv3697c vapC48 ribonuclease VapC48 527 527 ctx neighborhood:522
Rv3697A vapB48 antitoxin VapB48 520 520 ctx neighborhood:520
Rv2751 hyp hypothetical protein 503 504 ctx cooccurence:499
Rv2378c mbtG L-lysine N6-monooxygenase 447 447 ctx cooccurence:447
Rv3696c glpK glycerol kinase 444 443 ctx neighborhood:435
Rv0256c PPE2 PPE family protein PPE2 420 420 ctx cooccurence:415
Rv2687c antibiotic ABC transporter permease 416 416 ctx cooccurence:413
Rv0283 eccB3 ESX-3 secretion system protein EccB3 413 414 ctx cooccurence:412
Rv3896c hyp hypothetical protein 413 414 ctx cooccurence:410
Rv2686c antibiotic ABC transporter permease 410 410 ctx cooccurence:407
Rv2633c hyp hypothetical protein 404 404
Rv3707c hyp hypothetical protein 401 402 ctx cooccurence:400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: class I SAM-dependent methyltransferase
  • Pfam (hmmscan --cut_ga): TPMT PF05724.18 (E=1e-13), Methyltransf_23 PF13489.13 (E=2e-08), Methyltransf_31 PF13847.13 (E=3e-13), Methyltransf_25 PF13649.13 (E=2e-15), Methyltransf_11 PF08241.19 (E=4e-12), Methyltransf_12 PF08242.19 (E=3e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218216.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TPMT (PF05724.18), Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt O69667 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor eccD3
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003921|Rv3699|
MTDEVMDWDSAYREQGAFEGPPPWNIGEPQPELATLIAAGKVRSDVLDAGCGYAELSLALAADGYTVVGIDLTPTAVAAATKAAEERGLTTASFVQADITEFAAYPAGSAGRFSTVIDSTLFHSLPVDSRDRYLSSVHRAAAPGASYYVLVFAKGAFPAELEVKPNEVDEDELRAAVSKYWKIDEIRPAFIHVNPVTIPPQLAGAPVEFPPYDHDEKGRVKFPAYLLTAHKAG