Rv3699 Resolved · high auto-curated

H37Rv Rv3699 · MTBC0 mtbc0_003921 · 233 aa · 4165992–4166693 (+) · RefSeq NP_218216.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationclass I SAM-dependent methyltransferase
Revised (this work)Class I SAM-dependent methyltransferase. Pfam: TPMT (PF05724.18), Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69667 TrEMBL · unreviewed · Evidence at protein level
UniProt name2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase
EC (curated) EC 2.1.1.374

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionMethyltransferase
Orthologous groupCOG0500

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TPMTPF05724.18 1.2e-1322–186 Thiopurine S-methyltransferase (TPMT)
Methyltransf_23PF13489.13 2.2e-0831–154 Methyltransferase domain
Methyltransf_31PF13847.13 3.1e-1345–169 Methyltransferase domain
Methyltransf_25PF13649.13 1.8e-1546–144 Methyltransferase domain
Methyltransf_11PF08241.19 4.0e-1247–148 Methyltransferase domain
Methyltransf_12PF08242.19 2.5e-1047–145 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccD3 (ESX-3 secretion system protein EccD), medium confidence from genomic context alone (score 546 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3698 hyp hypothetical protein 717 716 ctx neighborhood:715
Rv0290 eccD3 ESX-3 secretion system protein EccD 545 546 ctx cooccurence:543
Rv3697c vapC48 ribonuclease VapC48 527 527 ctx neighborhood:522
Rv3697A vapB48 antitoxin VapB48 520 520 ctx neighborhood:520
Rv2751 hyp hypothetical protein 503 504 ctx cooccurence:499
Rv2378c mbtG L-lysine N6-monooxygenase 447 447 ctx cooccurence:447
Rv3696c glpK glycerol kinase 444 443 ctx neighborhood:435
Rv0256c PPE2 PPE family protein PPE2 420 420 ctx cooccurence:415
Rv2687c antibiotic ABC transporter permease 416 416 ctx cooccurence:413
Rv0283 eccB3 ESX-3 secretion system protein EccB3 413 414 ctx cooccurence:412
Rv3896c hyp hypothetical protein 413 414 ctx cooccurence:410
Rv2686c antibiotic ABC transporter permease 410 410 ctx cooccurence:407
Rv2633c hyp hypothetical protein 404 404
Rv3707c hyp hypothetical protein 401 402 ctx cooccurence:400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: class I SAM-dependent methyltransferase
  • Pfam (hmmscan --cut_ga): TPMT PF05724.18 (E=1e-13), Methyltransf_23 PF13489.13 (E=2e-08), Methyltransf_31 PF13847.13 (E=3e-13), Methyltransf_25 PF13649.13 (E=2e-15), Methyltransf_11 PF08241.19 (E=4e-12), Methyltransf_12 PF08242.19 (E=3e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218216.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TPMT (PF05724.18), Methyltransf_23 (PF13489.13), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt O69667 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor eccD3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003921|Rv3699|
MTDEVMDWDSAYREQGAFEGPPPWNIGEPQPELATLIAAGKVRSDVLDAGCGYAELSLALAADGYTVVGIDLTPTAVAAATKAAEERGLTTASFVQADITEFAAYPAGSAGRFSTVIDSTLFHSLPVDSRDRYLSSVHRAAAPGASYYVLVFAKGAFPAELEVKPNEVDEDELRAAVSKYWKIDEIRPAFIHVNPVTIPPQLAGAPVEFPPYDHDEKGRVKFPAYLLTAHKAG