Rv1810 Still unknown · low auto-curated
H37Rv Rv1810 · MTBC0 - ·
118 aa · 2052933–2053289 (+) ·
RefSeq NP_216326.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF732. Function unknown. Foldseek best (non-significant) hit: 2jps-assembly1_A NAB2 N-terminal domain (prob 0.20, TM 0.52). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O07222
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF732) |
| Orthologous group | 2B16Q |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF732 | PF05305.20 | 1.6e-18 | 40–111 | Protein of unknown function (DUF732) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 61.2 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
2jps-assembly1_A |
0.20 | 0.52 | 3.4e+00 | 2jps-assembly1_A NAB2 N-terminal domain |
3lcn-assembly2_B |
0.15 | 0.53 | 4.8e+00 | 3lcn-assembly2_B Nab2:Gfd1 complex |
4cjz-assembly1_B |
0.02 | 0.21 | 5.0e+00 | 4cjz-assembly1_B Crystal structure of the integral membrane diacylglycerol kinase DgkA- 9.9, delta 4 |
7p3r-assembly1_D |
0.01 | 0.20 | 9.5e+00 | 7p3r-assembly1_D Helical structure of the toxin MakA from Vibrio cholera |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mgtC (Mg2+ transport P-type ATPase MgtC), medium confidence from genomic context alone (score 569 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1811 mgtC |
Mg2+ transport P-type ATPase MgtC | 568 | 569 ctx | neighborhood:508 |
Rv1809 PPE33 |
PPE family protein PPE33 | 479 | 479 ctx | neighborhood:455 |
Rv1808 PPE32 |
PPE family protein PPE32 | 403 | 403 | |
Rv1352 hyp |
hypothetical protein | 808 | 63 | textmining:804 |
Rv3887c eccD2 |
ESX-2 secretion system protein EccD | 417 | 52 | textmining:411 |
Rv2290 lppO |
lipoprotein LppO | 805 | 51 | textmining:803 |
Rv1987 |
chitinase | 624 | 50 | textmining:621 |
Rv0063 |
oxidoreductase | 653 | 47 | textmining:651 |
Rv2035 hyp |
hypothetical protein | 632 | 47 | textmining:630 |
Rv3705c hyp |
hypothetical protein | 518 | 47 | textmining:515 |
Rv2253 hyp |
hypothetical protein | 514 | 47 | textmining:511 |
Rv0519c |
membrane protein | 549 | 41 | textmining:549 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): DUF732 PF05305.20 (E=2e-18)
- Foldseek best: 2jps-assembly1_A NAB2 N-terminal domain (prob 0.20, E=3e+00, TM=0.52)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216326.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B16Q - Curated reference: UniProt O07222 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 61.2, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
mgtC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1810| MQLQRTMGQCRPMRMLVALLLSAATMIGLAAPGKADPTGDDAAFLAALDQAGITYADPGHAITAAKAMCGLCANGVTGLQLVADLRDYNPGLTMDSAAKFAAIASGAYCPEHLEHHPS