Rv1810 Still unknown · low auto-curated

H37Rv Rv1810 · MTBC0 - · 118 aa · 2052933–2053289 (+) · RefSeq NP_216326.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF732. Function unknown. Foldseek best (non-significant) hit: 2jps-assembly1_A NAB2 N-terminal domain (prob 0.20, TM 0.52).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07222 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF732)
Orthologous group2B16Q

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF732PF05305.20 1.6e-1840–111 Protein of unknown function (DUF732)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 61.2 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2jps-assembly1_A 0.20 0.52 3.4e+00 2jps-assembly1_A NAB2 N-terminal domain
3lcn-assembly2_B 0.15 0.53 4.8e+00 3lcn-assembly2_B Nab2:Gfd1 complex
4cjz-assembly1_B 0.02 0.21 5.0e+00 4cjz-assembly1_B Crystal structure of the integral membrane diacylglycerol kinase DgkA- 9.9, delta 4
7p3r-assembly1_D 0.01 0.20 9.5e+00 7p3r-assembly1_D Helical structure of the toxin MakA from Vibrio cholera

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mgtC (Mg2+ transport P-type ATPase MgtC), medium confidence from genomic context alone (score 569 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1811 mgtC Mg2+ transport P-type ATPase MgtC 568 569 ctx neighborhood:508
Rv1809 PPE33 PPE family protein PPE33 479 479 ctx neighborhood:455
Rv1808 PPE32 PPE family protein PPE32 403 403
Rv1352 hyp hypothetical protein 808 63 textmining:804
Rv3887c eccD2 ESX-2 secretion system protein EccD 417 52 textmining:411
Rv2290 lppO lipoprotein LppO 805 51 textmining:803
Rv1987 chitinase 624 50 textmining:621
Rv0063 oxidoreductase 653 47 textmining:651
Rv2035 hyp hypothetical protein 632 47 textmining:630
Rv3705c hyp hypothetical protein 518 47 textmining:515
Rv2253 hyp hypothetical protein 514 47 textmining:511
Rv0519c membrane protein 549 41 textmining:549

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF732 PF05305.20 (E=2e-18)
  • Foldseek best: 2jps-assembly1_A NAB2 N-terminal domain (prob 0.20, E=3e+00, TM=0.52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216326.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B16Q
  • Curated reference: UniProt O07222 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 61.2, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor mgtC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1810|
MQLQRTMGQCRPMRMLVALLLSAATMIGLAAPGKADPTGDDAAFLAALDQAGITYADPGHAITAAKAMCGLCANGVTGLQLVADLRDYNPGLTMDSAAKFAAIASGAYCPEHLEHHPS