lprE Family assigned · medium auto-curated

H37Rv Rv1252c · MTBC0 mtbc0_001341 · 202 aa · 1407740–1408348 (-) · RefSeq NP_215768.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LprE
MTBC0 PGAP re-annotationLppP/LprE family lipoprotein
Revised (this work)LppP/LprE family lipoprotein. Pfam: Lipoprotein_21 (PF14041.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK49 SwissProt · reviewed · Evidence at protein level
UniProt namePutative lipoprotein LprE

UniProt still lists this protein as Putative lipoprotein LprE; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelprE
eggNOG descriptionLppP/LprE lipoprotein
Orthologous group2AS1M
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.236 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lipoprotein_21PF14041.12 3.5e-15113–190 LppP/LprE lipoprotein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: deaD (ATP-dependent RNA helicase DeaD), high confidence from genomic context alone (score 785 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2697c dut deoxyuridine 5'-triphosphate nucleotidohydrolase 964 963 experimental:837 database:782
Rv2529 hyp hypothetical protein 946 945 experimental:864 database:607
Rv1251c hyp hypothetical protein 905 902 ctx neighborhood:682 coexpression:703
Rv1629 polA DNA polymerase I 878 861 database:844
Rv1253 deaD ATP-dependent RNA helicase DeaD 797 785 ctx neighborhood:675
Rv3807c decaprenylphosphoryl-5-phosphoribose phosphatase 763 755 experimental:405 database:599
Rv0308 integral membrane protein 762 754 experimental:405 database:599
Rv0719 rplF 50S ribosomal protein L6 739 735 database:584
Rv1329c dinG ATP-dependent helicase DinG 711 712 database:543
Rv0641 rplA 50S ribosomal protein L1 705 697 database:542
Rv2116 lppK lipoprotein LppK 592 592 database:587
Rv0002 dnaN DNA polymerase III subunit beta 590 590 database:587
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 592 589
Rv0435c ATPase 587 587 database:542
Rv3884c eccA2 ESX-2 secretion system protein EccA 585 585 database:542

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LprE
  • MTBC0 PGAP product: LppP/LprE family lipoprotein
  • Pfam (hmmscan --cut_ga): Lipoprotein_21 PF14041.12 (E=4e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215768.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lipoprotein_21 (PF14041.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AS1M
  • Curated reference: UniProt P9WK49 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 137 functional partner(s); context anchor deaD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001341|Rv1252c|lprE
MPGVWSPPCPTTPRVGVVAALVAATLTGCGSGDSTVAKTPEATPSLSTAHPAPPSSEPSPPSATAAPPSNHSAAPVDPCAVNLASPTIAKVVSELPRDPRSEQPWNPEPLAGNYNECAQLSAVVIKANTNAGNPTTRAVMFHLGKYIPQGVPDTYGFTGIDTSQCTGDTVALTYASGIGLNNVVKFRWNGGGVELIGNTTGG