cyp125 Resolved · high auto-curated

H37Rv Rv3545c · MTBC0 - · 433 aa · 3984144–3985445 (-) · RefSeq NP_218062.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)steroid C26-monooxygenase
MTBC0 PGAP re-annotation
Revised (this work)Steroid C26-monooxygenase. Pfam: p450 (PF00067.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WPP1 SwissProt · reviewed · Evidence at protein level
UniProt nameSteroid C26-monooxygenase
EC (curated) EC 1.14.15.29
Curated functionInvolved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection. Primarily catalyzes the sequential oxidation of the terminal methyl of cholest-4-en-3-one into (25S)-26-hydroxycholest-4-en-3-one (alcohol), (25S)-26-oxocholest-4-en-3-one (aldehyde), to finally yield the carboxylic acid (25S)-3-oxocholest-4-en-26-oate. Also able to sequentially oxidize cholesterol itself, not only cholest-4-en-3-one.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namecyp125
eggNOG descriptioncytochrome p450
Orthologous groupCOG2124
EC number EC 1.14.13.141
KEGG orthology K15981
KEGG pathways map00984, map01120
Gene Ontology (45) GO:0003674, GO:0003824, GO:0004497, GO:0005488, GO:0006066, GO:0006629, GO:0006706, GO:0006707, GO:0008150, GO:0008152, GO:0008202, GO:0008203 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.15 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
p450PF00067.28 2.2e-13304–393 Cytochrome P450

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE28 (acyl-CoA dehydrogenase FadE28), high confidence from genomic context alone (score 929 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3800c pks13 polyketide synthase 943 938 experimental:891
Rv3544c fadE28 acyl-CoA dehydrogenase FadE28 987 929 ctx neighborhood:882 textmining:833
Rv3518c cyp142 cytochrome P450 monooxygenase Cyp142 943 922 database:900
Rv1106c 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase 960 917 database:900 textmining:546
Rv3543c fadE29 acyl-CoA dehydrogenase FadE29 983 916 ctx neighborhood:882 textmining:816
Rv3542c chsH2 hyp hypothetical protein 916 910 ctx neighborhood:866
Rv3541c chsH1 hyp hypothetical protein 968 907 ctx neighborhood:863 textmining:672
Rv3409c choD cholesterol oxidase 933 900 database:900
Rv3540c ltp2 lipid transfer protein 980 865 ctx neighborhood:836 textmining:865
Rv3515c fadD19 acyl-CoA synthetase 908 807 database:670 textmining:546
Rv2380c mbtE peptide synthetase 809 800 experimental:689
Rv1937 oxygenase 812 785 experimental:478
Rv2776c oxidoreductase 747 732
Rv0719 rplF 50S ribosomal protein L6 689 689 experimental:412 database:493
Rv1629 polA DNA polymerase I 706 687 database:638

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): steroid C26-monooxygenase
  • Pfam (hmmscan --cut_ga): p450 PF00067.28 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218062.1)
  • Domains: Pfam-A via hmmscan --cut_ga — p450 (PF00067.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2124
  • Curated reference: UniProt P9WPP1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 140 functional partner(s); context anchor fadE28
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3545c|cyp125
MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH