Rv0944 Resolved · high auto-curated

H37Rv Rv0944 · MTBC0 - · 158 aa · 1053765–1054241 (+) · RefSeq NP_215459.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)formamidopyrimidine-DNA glycosylase
MTBC0 PGAP re-annotation
Revised (this work)Formamidopyrimidine-DNA glycosylase. Pfam: H2TH (PF06831.20), zf-FPG_IleRS (PF06827.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0T864 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized formamidopyrimidine-DNA glycosylase-like protein

UniProt still lists this protein as Uncharacterized formamidopyrimidine-DNA glycosylase-like protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namemutM1
eggNOG descriptionBelongs to the FPG family
Orthologous groupCOG0266
EC number EC 3.2.2.23, EC 4.2.99.18
KEGG orthology K10563
KEGG pathways map03410

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.721 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
H2THPF06831.20 5.4e-1811–91 Formamidopyrimidine-DNA glycosylase H2TH domain
zf-FPG_IleRSPF06827.21 1.9e-07115–143 Zinc finger found in FPG and IleRS

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0945 (oxidoreductase), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2924c fpg formamidopyrimidine-DNA glycosylase 946 926 database:900
Rv0945 oxidoreductase 976 883 ctx neighborhood:881 textmining:808
Rv1629 polA DNA polymerase I 864 815 coexpression:790
Rv3297 nei endonuclease VIII 968 766 ctx cooccurence:766 textmining:870
Rv0943c monooxygenase 924 620 ctx neighborhood:618 textmining:808
Rv1903 membrane protein 556 557 ctx neighborhood:544
Rv2090 5'-3' exonuclease 552 524 coexpression:428
Rv1631 coaE dephospho-CoA kinase CoaE 554 512 coexpression:470
Rv1156 hyp hypothetical protein 530 503 coexpression:414
Rv3674c nth endonuclease III 548 418 coexpression:418
Rv1870c hyp hypothetical protein 449 418 coexpression:418
Rv2464c nei1 DNA glycosylase 428 282
Rv2737c recA recombinase A 437 253
Rv3589 mutY A/G-specific adenine glycosylase 776 125 textmining:755
Rv2926c hyp hypothetical protein 526 73 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): formamidopyrimidine-DNA glycosylase
  • Pfam (hmmscan --cut_ga): H2TH PF06831.20 (E=5e-18), zf-FPG_IleRS PF06827.21 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215459.1)
  • Domains: Pfam-A via hmmscan --cut_ga — H2TH (PF06831.20), zf-FPG_IleRS (PF06827.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0266
  • Curated reference: UniProt L0T864 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv0945
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0944|
MAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKISPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPVCGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK