lipV Resolved · high auto-curated

H37Rv Rv3203 · MTBC0 - · 224 aa · 3580638–3581312 (+) · RefSeq NP_217719.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipase LipV
MTBC0 PGAP re-annotation
Revised (this work)Lipase LipV. Pfam: Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14), Abhydrolase_1 (PF00561.27), Ser_hydrolase (PF06821.20), Thioesterase (PF00975.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0TC47 SwissProt · reviewed · Evidence at protein level
UniProt nameLipase LipV
EC (curated) EC 3.1.1.1
Curated functionLipase that displays broad substrate specificity and preferentially hydrolyzes p-nitrophenyl myristate in vitro. Also shows significant activity with pNP-butyrate (68%), pNP-octanoate (82%), pNP-decanoate (90%), and pNP-laurate (74%). Is probably involved in lipid catabolism. Is active at low pH, and might play some important role in mycobacterial biology in macrophages where the bacteria encounters acidic stress.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelipV
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG0596
KEGG orthology K19311
Gene Ontology (47) GO:0003674, GO:0003824, GO:0005488, GO:0005504, GO:0006082, GO:0006629, GO:0006631, GO:0008150, GO:0008152, GO:0008289, GO:0009056, GO:0009062 +35 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Hydrolase_4PF12146.16 3.8e-106–122 Serine aminopeptidase, S33
Abhydrolase_6PF12697.14 2.0e-177–216 Alpha/beta hydrolase family
Abhydrolase_1PF00561.27 4.1e-137–78 alpha/beta hydrolase fold
Ser_hydrolasePF06821.20 1.7e-0427–79 Serine hydrolase
ThioesterasePF00975.27 1.6e-0632–74 Thioesterase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3204 (DNA-methyltransferase), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3204 DNA-methyltransferase 884 884 ctx neighborhood:882
Rv3591c hydrolase 626 627 ctx cooccurence:625
Rv3201c adnB ATP-dependent DNA helicase 544 544 ctx neighborhood:544
Rv2001 hyp hypothetical protein 499 500 ctx cooccurence:498
Rv1527c pks5 polyketide synthase 526 499 experimental:441
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 526 499 experimental:441
Rv2048c pks12 polyketide synthase 526 498 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 526 498 experimental:441
Rv2940c mas multifunctional mycocerosic acid synthase 526 498 experimental:441
Rv1683 bifunctional long-chain acyl-CoA synthase/lipase 515 491 ctx cooccurence:412
Rv2946c pks1 polyketide synthase 486 455
Rv1274 lprB lipoprotein LprB 454 455 ctx cooccurence:453
Rv2390c hyp hypothetical protein 448 448
Rv1972 Mce associated membrane protein 442 442
Rv1661 pks7 polyketide synthase 452 427

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): lipase LipV
  • Pfam (hmmscan --cut_ga): Hydrolase_4 PF12146.16 (E=4e-10), Abhydrolase_6 PF12697.14 (E=2e-17), Abhydrolase_1 PF00561.27 (E=4e-13), Ser_hydrolase PF06821.20 (E=2e-04), Thioesterase PF00975.27 (E=2e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217719.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14), Abhydrolase_1 (PF00561.27), Ser_hydrolase (PF06821.20), Thioesterase (PF00975.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0596
  • Curated reference: UniProt L0TC47 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor Rv3204
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3203|lipV
MPEIPIAAPDLLGHGRSPWAAPWTIDANVSALAALLDNQGDGPVVVVGHSFGGAVAMHLAAARPDQVAALVLLDPAVALDGSRVREVVDAMLASPDYLDPAEARAEKATGAWADVDPPVLDAELDEHLVALPNGRYGWRISLPAMVCYWSELARDIVLPPVGTATTLVRAVRASPAYVSDQLLAALDKRLGADFELLDFDCGHMVPQAKPTEVAAVIRSRLGPR