Rv3196A Still unknown · low auto-curated
H37Rv Rv3196A · MTBC0 - ·
66 aa · 3566696–3566896 (-) ·
RefSeq YP_177939.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 4jq5-assembly2_H Crystal structure of the human Nup49CCS2+3* coiled-co (prob 0.66, TM 0.87). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N668
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 29IWX |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 66.4 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
4jq5-assembly2_H |
0.66 | 0.87 | 4.1e+00 | 4jq5-assembly2_H Crystal structure of the human Nup49CCS2+3* coiled-coil segment |
4jq5-assembly1_B |
0.60 | 0.86 | 4.7e+00 | 4jq5-assembly1_B Crystal structure of the human Nup49CCS2+3* coiled-coil segment |
3sjr-assembly2_D |
0.60 | 0.78 | 3.0e+00 | 3sjr-assembly2_D Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472 |
2osz-assembly1_A |
0.51 | 0.88 | 5.7e+00 | 2osz-assembly1_A Structure of Nup58/45 suggests flexible nuclear pore diameter by intermolecular sliding |
4jq5-assembly3_K |
0.47 | 0.86 | 6.1e+00 | 4jq5-assembly3_K Crystal structure of the human Nup49CCS2+3* coiled-coil segment |
2osz-assembly2_C |
0.41 | 0.87 | 7.4e+00 | 2osz-assembly2_C Structure of Nup58/45 suggests flexible nuclear pore diameter by intermolecular sliding |
3l9f-assembly2_C |
0.41 | 0.74 | 4.7e+00 | 3l9f-assembly2_C The Crystal Structure of smu.1604c from Streptococcus mutans UA159 |
3sjr-assembly2_C |
0.38 | 0.73 | 4.7e+00 | 3sjr-assembly2_C Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3197 (ABC transporter ATP-binding protein), medium confidence from genomic context alone (score 546 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3197 |
ABC transporter ATP-binding protein | 546 | 546 ctx | neighborhood:543 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 4jq5-assembly2_H Crystal structure of the human Nup49CCS2+3* coiled-coil segment (prob 0.66, E=4e+00, TM=0.87)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177939.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
29IWX - Curated reference: UniProt L7N668 (TrEMBL, unreviewed; Evidence at protein level)
- Model confidence: ESMFold per-residue pLDDT (mean 66.4, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
1 functional partner(s); context anchor
Rv3197 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3196A| MQEGGPQETMSARSTQHDAADALFRAIIETLDKHRNERTLTEDVLDTLARAYASISTNVPEQGRLG