Rv3196A Still unknown · low auto-curated

H37Rv Rv3196A · MTBC0 - · 66 aa · 3566696–3566896 (-) · RefSeq YP_177939.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 4jq5-assembly2_H Crystal structure of the human Nup49CCS2+3* coiled-co (prob 0.66, TM 0.87).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N668 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group29IWX

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 66.4 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
4jq5-assembly2_H 0.66 0.87 4.1e+00 4jq5-assembly2_H Crystal structure of the human Nup49CCS2+3* coiled-coil segment
4jq5-assembly1_B 0.60 0.86 4.7e+00 4jq5-assembly1_B Crystal structure of the human Nup49CCS2+3* coiled-coil segment
3sjr-assembly2_D 0.60 0.78 3.0e+00 3sjr-assembly2_D Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472
2osz-assembly1_A 0.51 0.88 5.7e+00 2osz-assembly1_A Structure of Nup58/45 suggests flexible nuclear pore diameter by intermolecular sliding
4jq5-assembly3_K 0.47 0.86 6.1e+00 4jq5-assembly3_K Crystal structure of the human Nup49CCS2+3* coiled-coil segment
2osz-assembly2_C 0.41 0.87 7.4e+00 2osz-assembly2_C Structure of Nup58/45 suggests flexible nuclear pore diameter by intermolecular sliding
3l9f-assembly2_C 0.41 0.74 4.7e+00 3l9f-assembly2_C The Crystal Structure of smu.1604c from Streptococcus mutans UA159
3sjr-assembly2_C 0.38 0.73 4.7e+00 3sjr-assembly2_C Crystal structure of conserved unkown function protein CV_1783 from Chromobacterium violaceum ATCC 12472

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3197 (ABC transporter ATP-binding protein), medium confidence from genomic context alone (score 546 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3197 ABC transporter ATP-binding protein 546 546 ctx neighborhood:543

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 4jq5-assembly2_H Crystal structure of the human Nup49CCS2+3* coiled-coil segment (prob 0.66, E=4e+00, TM=0.87)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177939.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 29IWX
  • Curated reference: UniProt L7N668 (TrEMBL, unreviewed; Evidence at protein level)
  • Model confidence: ESMFold per-residue pLDDT (mean 66.4, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 1 functional partner(s); context anchor Rv3197
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3196A|
MQEGGPQETMSARSTQHDAADALFRAIIETLDKHRNERTLTEDVLDTLARAYASISTNVPEQGRLG