nuoJ Family assigned · medium auto-curated
H37Rv Rv3154 · MTBC0 mtbc0_003352 ·
262 aa ·
3543841–3544629 MTBC0
(+) ·
RefSeq NP_217670.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NADH-quinone oxidoreductase subunit J |
|---|---|
| MTBC0 PGAP re-annotation | NADH-quinone oxidoreductase subunit J |
| Revised (this work) | NADH-quinone oxidoreductase subunit J. Pfam: Oxidored_q3 (PF00499.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Respiratory chain gene mutations associated with global phylogenetic clustering of drug-resistant Mycobacterium tuberculosis revealed by whole-genome sequencing. doi:10.3389/fimmu.2026.1724194 | 2026 |
| Association of mutations in Mycobacterium tuberculosis complex (MTBC) respiration chain genes with hyper-transmission. doi:10.1186/s12864-024-10726-z | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 31% of residues (metapredict) · mean AlphaFold pLDDT 83.1 |
|---|---|
| Disordered regions | 1 IDR(s), longest 73 aa [189-262] |
carries a substantial disordered region (73/262 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | nuoI (Rv3153, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Mce1R (mce1R).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.00 (95% CI -0.70 to 3.59). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol]. |
|---|---|
| Mycobrowser EC |
1.6.5.3
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3178
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1474
· 88.8% identity |
| M. smegmatis |
MSMEG_2054
· 74.7% identity |
| M. orygis |
RJtmp_003249
· 100.0% identity |
| M. abscessus |
MAB_2143
· 67.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P95172
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | NADH-quinone oxidoreductase subunit J |
| EC (curated) |
EC 7.1.1.-
|
| Curated function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | nuoJ |
| eggNOG description | Belongs to the complex I subunit 6 family |
| Orthologous group | COG0839 |
| EC number |
EC 1.6.5.3
|
| KEGG orthology |
K00339
|
| KEGG pathways |
map00190, map01100
|
| KEGG modules |
M00144
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.094 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 85.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 63.7% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 83.9. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) carbon source
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| Sodium propionate | carbon source | mutant depleted (gene required) | -2.527 | -7.782 |
| L-Asparagine | carbon source | mutant depleted (gene required) | -1.293 | -5.399 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (2 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +2.24 | 0.024 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 134.0 ppm · rank 1086/3519 (69.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (5 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 5 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 262 aa |
|---|---|
| Molecular weight | 27.6 kDa |
| Theoretical pI | 8.09 |
| GRAVY | 0.661 (hydrophobic) |
| Aliphatic index | 114.3 |
| Aromaticity | 0.076 |
| Instability index | 21.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Oxidored_q3 | PF00499.26 | 3.6e-35 | 31–176 | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8e9g-assembly1_J |
1.00 | 0.71 | 4.7e-20 sig | 8e9g-assembly1_J Mycobacterial respiratory complex I with both quinone positions modelled |
4he8-assembly2_D |
1.00 | 0.78 | 2.7e-06 sig | 4he8-assembly2_D Crystal structure of the membrane domain of respiratory complex I from Thermus thermophilus |
4hea-assembly1_J |
1.00 | 0.79 | 3.2e-06 sig | 4hea-assembly1_J Crystal structure of the entire respiratory complex I from Thermus thermophilus |
8e73-assembly1_6M |
1.00 | 0.70 | 1.6e-06 sig | 8e73-assembly1_6M Vigna radiata supercomplex I+III2 (full bridge) |
6tjv-assembly1_G |
1.00 | 0.75 | 2.7e-06 sig | 6tjv-assembly1_G Structure of the NDH-1MS complex from Thermosynechococcus elongatus |
Foldseek search of the AlphaFold DB model (mean pLDDT 83.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 7
| Upstream (5' on genome) | nuoI (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | nuoK (+ strand, -4 bp gap) |
| Predicted operon |
nuoH · nuoI · nuoJ · nuoK · nuoL · nuoM · nuoN
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
csoR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: nuoD (NADH-quinone oxidoreductase subunit D), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3148 nuoD exp |
NADH-quinone oxidoreductase subunit D | 999 | 1000 ctx | neighborhood:764 cooccurence:737 coexpression:864 experimental:997 |
Rv3145 nuoA exp |
NADH-quinone oxidoreductase subunit A | 999 | 1000 ctx | neighborhood:762 cooccurence:766 coexpression:858 experimental:997 textmining:675 |
Rv3157 nuoM exp |
NADH-quinone oxidoreductase subunit M | 999 | 1000 ctx | neighborhood:874 cooccurence:720 coexpression:976 experimental:922 textmining:687 |
Rv3156 nuoL exp |
NADH-quinone oxidoreductase subunit L | 999 | 1000 ctx | neighborhood:874 cooccurence:748 coexpression:976 experimental:997 textmining:714 |
Rv3153 nuoI exp |
NADH-quinone oxidoreductase subunit I | 999 | 1000 ctx | neighborhood:882 cooccurence:765 coexpression:970 experimental:922 textmining:734 |
Rv3146 nuoB exp |
NADH-quinone oxidoreductase subunit B | 999 | 1000 ctx | neighborhood:764 cooccurence:682 coexpression:937 experimental:997 |
Rv3152 nuoH exp |
NADH-quinone oxidoreductase subunit H | 999 | 1000 ctx | neighborhood:881 cooccurence:751 coexpression:976 experimental:997 textmining:688 |
Rv3151 nuoG exp |
NADH-quinone oxidoreductase subunit G | 999 | 1000 ctx | neighborhood:764 cooccurence:745 coexpression:962 experimental:911 |
Rv3158 nuoN exp |
NADH-quinone oxidoreductase subunit N | 999 | 1000 ctx | neighborhood:874 cooccurence:756 coexpression:976 experimental:997 textmining:751 |
Rv3147 nuoC exp |
NADH-quinone oxidoreductase subunit C | 999 | 1000 ctx | neighborhood:764 cooccurence:771 coexpression:859 experimental:997 textmining:629 |
Rv3155 nuoK exp |
NADH-quinone oxidoreductase subunit K | 999 | 1000 ctx | neighborhood:882 cooccurence:769 coexpression:951 experimental:997 textmining:821 |
Rv3150 nuoF exp |
NADH-quinone oxidoreductase subunit F | 999 | 999 ctx | neighborhood:764 cooccurence:541 coexpression:953 experimental:911 |
Rv3143 exp |
response regulator | 999 | 999 ctx | cooccurence:695 experimental:997 |
Rv3149 nuoE exp |
NADH-quinone oxidoreductase subunit E | 999 | 999 ctx | neighborhood:764 cooccurence:615 coexpression:932 experimental:911 |
Rv0172 mce1D |
Mce family protein Mce1D | 799 | 799 | coexpression:799 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NADH-quinone oxidoreductase subunit J
- MTBC0 PGAP product: NADH-quinone oxidoreductase subunit J
- Pfam (hmmscan --cut_ga): Oxidored_q3 PF00499.26 (E=4e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217670.1)
- Domains: Pfam-A via hmmscan --cut_ga — Oxidored_q3 (PF00499.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0839 - Curated reference: UniProt P95172 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
49 functional partner(s); context anchor
nuoD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003352|Rv3154|nuoJ MTAVLASDVIVRTSTGEAVMFWVLSALALLGAVGVVLAVNAVYSAMFLAMTMIILAVFYMAQDALFLGVVQVVVYTGAVMMLFLFVLMLIGVDSAESLKETLRGQRVAAVLTGVGFGVLLISTIGQVATRGFAGLTVANANGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRERFERRKTQRELSQERFRPGGHPTPLPNPGVYARHNAVDVAALLPDGSYSELSVPRMLRTRGADGLQTPSPGAVSGSLEGGAS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for nuoJ? Email the maintainer — the message is pre-filled with this gene's details.