hisN Resolved · high auto-curated
H37Rv Rv3137 · MTBC0 mtbc0_003335 ·
260 aa · 3526095–3526877 (+) ·
RefSeq NP_217653.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | histidinol-phosphatase |
|---|---|
| MTBC0 PGAP re-annotation | histidinol-phosphatase |
| Revised (this work) | Histidinol-phosphatase. Pfam: Inositol_P (PF00459.31). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P95189
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Histidinol-phosphatase |
| EC (curated) |
EC 3.1.3.15
|
| Curated function | Catalyzes the dephosphorylation of histidinol-phosphate to histidinol, the direct precursor of histidine. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| Preferred name | hisN |
| eggNOG description | Inositol monophosphatase |
| Orthologous group | COG0483 |
| EC number |
EC 3.1.3.15, EC 3.1.3.25
|
| KEGG orthology |
K01092, K05602
|
| KEGG pathways |
map00340, map00521, map00562, map01100, map01110, map01230, map04070
|
| KEGG modules |
M00026, M00131
|
| Gene Ontology (70) |
GO:0000105, GO:0003674, GO:0003824, GO:0004401, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082, GO:0006520 +58 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.125 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Inositol_P | PF00459.31 | 2.0e-45 | 9–254 | Inositol monophosphatase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pflA (pyruvate formate lyase activating protein PflA), high confidence from genomic context alone (score 888 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1599 hisD |
histidinol dehydrogenase | 941 | 921 | database:900 |
Rv1600 hisC1 |
histidinol-phosphate aminotransferase | 920 | 915 | database:900 |
Rv2231c cobC |
aminotransferase | 908 | 903 | database:900 |
Rv3772 hisC2 |
histidinol-phosphate aminotransferase | 908 | 903 | database:900 |
Rv3138 pflA |
pyruvate formate lyase activating protein PflA | 937 | 888 ctx | neighborhood:855 textmining:462 |
Rv3136A hyp |
hypothetical protein | 778 | 778 ctx | neighborhood:778 |
Rv3135 PPE50 |
PPE family protein PPE50 | 733 | 733 | coexpression:733 |
Rv3139 fadE24 |
acyl-CoA dehydrogenase | 662 | 606 ctx | neighborhood:602 |
Rv2841c nusA |
transcription termination/antitermination protein NusA | 565 | 564 | experimental:484 |
Rv3140 fadE23 |
acyl-CoA dehydrogenase FadE23 | 640 | 547 ctx | neighborhood:543 |
Rv1407 fmu |
16S rRNA m5C967 methyltransferase | 634 | 508 | experimental:405 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 503 | 504 | experimental:484 |
Rv0668 rpoC |
DNA-directed RNA polymerase subunit beta' | 502 | 497 | experimental:484 |
Rv0667 rpoB |
DNA-directed RNA polymerase subunit beta | 491 | 492 | experimental:484 |
Rv0639 nusG |
transcription termination/antitermination protein NusG | 527 | 476 | experimental:449 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: histidinol-phosphatase
- MTBC0 PGAP product: histidinol-phosphatase
- Pfam (hmmscan --cut_ga): Inositol_P PF00459.31 (E=2e-45)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217653.1)
- Domains: Pfam-A via hmmscan --cut_ga — Inositol_P (PF00459.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0483 - Curated reference: UniProt P95189 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
pflA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003335|Rv3137|hisN MSHDDLMLALALADRADELTRVRFGALDLRIDTKPDLTPVTDADRAVESDVRQTLGRDRPGDGVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAPALQRRWWAARGRGAFASVDGARPHRLSVSSVAELHSASLSFSSLSGWARLGLRERFIGLTDTVWRVRAYGDFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAGPHGGSAVATNGLLHDEVLTRLNAG