nuoK Family assigned · medium auto-curated
H37Rv Rv3155 · MTBC0 mtbc0_003353 ·
99 aa ·
3544626–3544925 MTBC0
(+) ·
RefSeq NP_217671.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NADH-quinone oxidoreductase subunit K |
|---|---|
| MTBC0 PGAP re-annotation | NADH-quinone oxidoreductase subunit NuoK |
| Revised (this work) | NADH-quinone oxidoreductase subunit NuoK. Pfam: Oxidored_q2 (PF00420.30). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Respiratory chain gene mutations associated with global phylogenetic clustering of drug-resistant Mycobacterium tuberculosis revealed by whole-genome sequencing. doi:10.3389/fimmu.2026.1724194 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | nuoJ (Rv3154, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.57 (95% CI -2.60 to 1.89). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol]. |
|---|---|
| Mycobrowser EC |
1.6.99.5
· superseded EC numbering; the atlas uses the current class (1.6.5.3, 7.1.1.-)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3179
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1473
· 98.0% identity |
| M. smegmatis |
MSMEG_2053
· 87.8% identity |
| M. orygis |
RJtmp_003250
· 100.0% identity |
| M. abscessus |
MAB_2144
· 82.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIX3
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | NADH-quinone oxidoreductase subunit K |
| EC (curated) |
EC 7.1.1.-
|
| Curated function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | nuoK |
| eggNOG description | NDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient |
| Orthologous group | COG0713 |
| EC number |
EC 1.6.5.3
|
| KEGG orthology |
K00340, K05576
|
| KEGG pathways |
map00190, map01100
|
| KEGG modules |
M00144, M00145
|
| Gene Ontology (30) |
GO:0003674, GO:0003824, GO:0003954, GO:0005575, GO:0005623, GO:0005886, GO:0008137, GO:0008150, GO:0008152, GO:0016020, GO:0016491, GO:0016651 +18 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 94.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 73.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 6 in the ORF — 0 in the essential state, 0 growth-defect, 6 non-essential, 0 growth-advantage. Saturation 0.833, mean read count 44.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 6 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 6 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +1.59 | 0.021 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 14.1 ppm · rank 2522/3519 (28.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (3 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 3 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 99 aa |
|---|---|
| Molecular weight | 10.9 kDa |
| Theoretical pI | 8.8 |
| GRAVY | 0.994 (hydrophobic) |
| Aliphatic index | 123.1 |
| Aromaticity | 0.091 |
| Instability index | 23.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Oxidored_q2 | PF00420.30 | 6.9e-31 | 6–99 | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8e9i-assembly1_K |
1.00 | 0.95 | 3.7e-12 sig | 8e9i-assembly1_K Mycobacterial respiratory complex I, semi-inserted quinone |
8qby-assembly1_K |
1.00 | 0.96 | 3.0e-07 sig | 8qby-assembly1_K Respiratory complex I from Paracoccus denitrificans in MSP2N2 nanodiscs |
7p64-assembly1_K |
1.00 | 0.95 | 9.3e-07 sig | 7p64-assembly1_K Complex I from E. coli, DDM/LMNG-purified, under Turnover at pH 6, Open state |
4he8-assembly1_K |
1.00 | 0.94 | 7.3e-07 sig | 4he8-assembly1_K Crystal structure of the membrane domain of respiratory complex I from Thermus thermophilus |
6khi-assembly1_E |
1.00 | 0.94 | 1.1e-06 sig | 6khi-assembly1_E Supercomplex for cylic electron transport in cyanobacteria |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 7
| Upstream (5' on genome) | nuoJ (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | nuoL (+ strand, 10 bp gap) |
| Predicted operon |
nuoH · nuoI · nuoJ · nuoK · nuoL · nuoM · nuoN
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
csoR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: nuoJ (NADH-quinone oxidoreductase subunit J), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3154 nuoJ exp |
NADH-quinone oxidoreductase subunit J | 999 | 1000 ctx | neighborhood:882 cooccurence:769 coexpression:951 experimental:997 textmining:821 |
Rv3147 nuoC exp |
NADH-quinone oxidoreductase subunit C | 999 | 1000 ctx | neighborhood:764 cooccurence:765 coexpression:976 experimental:928 textmining:882 |
Rv3158 nuoN exp |
NADH-quinone oxidoreductase subunit N | 999 | 1000 ctx | neighborhood:874 cooccurence:773 coexpression:949 experimental:997 textmining:689 |
Rv3146 nuoB exp |
NADH-quinone oxidoreductase subunit B | 999 | 1000 ctx | neighborhood:764 cooccurence:760 coexpression:979 experimental:924 |
Rv3153 nuoI exp |
NADH-quinone oxidoreductase subunit I | 999 | 1000 ctx | neighborhood:882 cooccurence:762 coexpression:979 experimental:922 textmining:653 |
Rv3152 nuoH exp |
NADH-quinone oxidoreductase subunit H | 999 | 1000 ctx | neighborhood:881 cooccurence:773 coexpression:957 experimental:924 textmining:625 |
Rv3157 nuoM exp |
NADH-quinone oxidoreductase subunit M | 999 | 1000 ctx | neighborhood:874 cooccurence:766 coexpression:898 experimental:922 textmining:622 |
Rv3156 nuoL exp |
NADH-quinone oxidoreductase subunit L | 999 | 1000 ctx | neighborhood:874 cooccurence:771 coexpression:913 experimental:997 textmining:625 |
Rv3145 nuoA exp |
NADH-quinone oxidoreductase subunit A | 999 | 1000 ctx | neighborhood:762 cooccurence:774 coexpression:979 experimental:997 textmining:625 |
Rv3148 nuoD exp |
NADH-quinone oxidoreductase subunit D | 999 | 1000 ctx | neighborhood:764 cooccurence:763 coexpression:960 experimental:928 |
Rv3151 nuoG exp |
NADH-quinone oxidoreductase subunit G | 999 | 998 ctx | neighborhood:764 coexpression:859 experimental:911 textmining:630 |
Rv3150 nuoF exp |
NADH-quinone oxidoreductase subunit F | 998 | 998 ctx | neighborhood:764 coexpression:876 experimental:911 |
Rv3149 nuoE exp |
NADH-quinone oxidoreductase subunit E | 999 | 996 ctx | neighborhood:764 coexpression:812 experimental:911 textmining:746 |
Rv3143 exp |
response regulator | 901 | 896 | experimental:870 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 688 | 652 | coexpression:651 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NADH-quinone oxidoreductase subunit K
- MTBC0 PGAP product: NADH-quinone oxidoreductase subunit NuoK
- Pfam (hmmscan --cut_ga): Oxidored_q2 PF00420.30 (E=7e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217671.1)
- Domains: Pfam-A via hmmscan --cut_ga — Oxidored_q2 (PF00420.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0713 - Curated reference: UniProt P9WIX3 (SwissProt, reviewed; Inferred from homology)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
59 functional partner(s); context anchor
nuoJ - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003353|Rv3155|nuoK MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMIAFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for nuoK? Email the maintainer — the message is pre-filled with this gene's details.