nuoK Family assigned · medium auto-curated

H37Rv Rv3155 · MTBC0 mtbc0_003353 · 99 aa · 3544626–3544925 (+) · RefSeq NP_217671.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)NADH-quinone oxidoreductase subunit K
MTBC0 PGAP re-annotationNADH-quinone oxidoreductase subunit NuoK
Revised (this work)NADH-quinone oxidoreductase subunit NuoK. Pfam: Oxidored_q2 (PF00420.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIX3 SwissProt · reviewed · Inferred from homology
UniProt nameNADH-quinone oxidoreductase subunit K
EC (curated) EC 7.1.1.-
Curated functionNDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namenuoK
eggNOG descriptionNDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient
Orthologous groupCOG0713
EC number EC 1.6.5.3
KEGG orthology K00340, K05576
KEGG pathways map00190, map01100
KEGG modules M00144, M00145
Gene Ontology (30) GO:0003674, GO:0003824, GO:0003954, GO:0005575, GO:0005623, GO:0005886, GO:0008137, GO:0008150, GO:0008152, GO:0016020, GO:0016491, GO:0016651 +18 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Oxidored_q2PF00420.30 6.9e-316–99 NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nuoJ (NADH-quinone oxidoreductase subunit J), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3154 nuoJ NADH-quinone oxidoreductase subunit J 999 1000 ctx neighborhood:882 cooccurence:769 coexpression:951 experimental:997 textmining:821
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 999 1000 ctx neighborhood:764 cooccurence:765 coexpression:976 experimental:928 textmining:882
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 999 1000 ctx neighborhood:874 cooccurence:773 coexpression:949 experimental:997 textmining:689
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 999 1000 ctx neighborhood:764 cooccurence:760 coexpression:979 experimental:924
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 999 1000 ctx neighborhood:882 cooccurence:762 coexpression:979 experimental:922 textmining:653
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 999 1000 ctx neighborhood:881 cooccurence:773 coexpression:957 experimental:924 textmining:625
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 999 1000 ctx neighborhood:874 cooccurence:766 coexpression:898 experimental:922 textmining:622
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 999 1000 ctx neighborhood:874 cooccurence:771 coexpression:913 experimental:997 textmining:625
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 999 1000 ctx neighborhood:762 cooccurence:774 coexpression:979 experimental:997 textmining:625
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 999 1000 ctx neighborhood:764 cooccurence:763 coexpression:960 experimental:928
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 999 998 ctx neighborhood:764 coexpression:859 experimental:911 textmining:630
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 998 998 ctx neighborhood:764 coexpression:876 experimental:911
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 999 996 ctx neighborhood:764 coexpression:812 experimental:911 textmining:746
Rv3143 response regulator 901 896 experimental:870
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 688 652 coexpression:651

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: NADH-quinone oxidoreductase subunit K
  • MTBC0 PGAP product: NADH-quinone oxidoreductase subunit NuoK
  • Pfam (hmmscan --cut_ga): Oxidored_q2 PF00420.30 (E=7e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217671.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Oxidored_q2 (PF00420.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0713
  • Curated reference: UniProt P9WIX3 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor nuoJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003353|Rv3155|nuoK
MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMIAFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG