nuoK Family assigned · medium auto-curated
H37Rv Rv3155 · MTBC0 mtbc0_003353 ·
99 aa · 3544626–3544925 (+) ·
RefSeq NP_217671.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NADH-quinone oxidoreductase subunit K |
|---|---|
| MTBC0 PGAP re-annotation | NADH-quinone oxidoreductase subunit NuoK |
| Revised (this work) | NADH-quinone oxidoreductase subunit NuoK. Pfam: Oxidored_q2 (PF00420.30). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIX3
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | NADH-quinone oxidoreductase subunit K |
| EC (curated) |
EC 7.1.1.-
|
| Curated function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | nuoK |
| eggNOG description | NDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient |
| Orthologous group | COG0713 |
| EC number |
EC 1.6.5.3
|
| KEGG orthology |
K00340, K05576
|
| KEGG pathways |
map00190, map01100
|
| KEGG modules |
M00144, M00145
|
| Gene Ontology (30) |
GO:0003674, GO:0003824, GO:0003954, GO:0005575, GO:0005623, GO:0005886, GO:0008137, GO:0008150, GO:0008152, GO:0016020, GO:0016491, GO:0016651 +18 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Oxidored_q2 | PF00420.30 | 6.9e-31 | 6–99 | NADH-ubiquinone/plastoquinone oxidoreductase chain 4L |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: nuoJ (NADH-quinone oxidoreductase subunit J), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3154 nuoJ |
NADH-quinone oxidoreductase subunit J | 999 | 1000 ctx | neighborhood:882 cooccurence:769 coexpression:951 experimental:997 textmining:821 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 999 | 1000 ctx | neighborhood:764 cooccurence:765 coexpression:976 experimental:928 textmining:882 |
Rv3158 nuoN |
NADH-quinone oxidoreductase subunit N | 999 | 1000 ctx | neighborhood:874 cooccurence:773 coexpression:949 experimental:997 textmining:689 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 999 | 1000 ctx | neighborhood:764 cooccurence:760 coexpression:979 experimental:924 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 999 | 1000 ctx | neighborhood:882 cooccurence:762 coexpression:979 experimental:922 textmining:653 |
Rv3152 nuoH |
NADH-quinone oxidoreductase subunit H | 999 | 1000 ctx | neighborhood:881 cooccurence:773 coexpression:957 experimental:924 textmining:625 |
Rv3157 nuoM |
NADH-quinone oxidoreductase subunit M | 999 | 1000 ctx | neighborhood:874 cooccurence:766 coexpression:898 experimental:922 textmining:622 |
Rv3156 nuoL |
NADH-quinone oxidoreductase subunit L | 999 | 1000 ctx | neighborhood:874 cooccurence:771 coexpression:913 experimental:997 textmining:625 |
Rv3145 nuoA |
NADH-quinone oxidoreductase subunit A | 999 | 1000 ctx | neighborhood:762 cooccurence:774 coexpression:979 experimental:997 textmining:625 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 999 | 1000 ctx | neighborhood:764 cooccurence:763 coexpression:960 experimental:928 |
Rv3151 nuoG |
NADH-quinone oxidoreductase subunit G | 999 | 998 ctx | neighborhood:764 coexpression:859 experimental:911 textmining:630 |
Rv3150 nuoF |
NADH-quinone oxidoreductase subunit F | 998 | 998 ctx | neighborhood:764 coexpression:876 experimental:911 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 999 | 996 ctx | neighborhood:764 coexpression:812 experimental:911 textmining:746 |
Rv3143 |
response regulator | 901 | 896 | experimental:870 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 688 | 652 | coexpression:651 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NADH-quinone oxidoreductase subunit K
- MTBC0 PGAP product: NADH-quinone oxidoreductase subunit NuoK
- Pfam (hmmscan --cut_ga): Oxidored_q2 PF00420.30 (E=7e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217671.1)
- Domains: Pfam-A via hmmscan --cut_ga — Oxidored_q2 (PF00420.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0713 - Curated reference: UniProt P9WIX3 (SwissProt, reviewed; Inferred from homology)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
59 functional partner(s); context anchor
nuoJ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003353|Rv3155|nuoK MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMIAFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG