Rv3037c Resolved · high auto-curated
H37Rv Rv3037c · MTBC0 - ·
358 aa ·
3397214–3398290 H37Rv
(-) ·
RefSeq NP_217553.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | S-adenosylmethionine-dependent methyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | S-adenosylmethionine-dependent methyltransferase. Pfam: Thump_like (PF18096.7). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 2 in other mycobacteria — M. marinum (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| A novel ESX-1 locus reveals that surface-associated ESX-1 substrates mediate virulence in Mycobacterium marinum. doi:10.1128/JB.01502-14 | 2014 |
| Biosynthesis of mycobacterial methylglucose lipopolysaccharides. doi:10.1039/c2np20014g | 2012 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.46 (95% CI -1.15 to 2.77). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3063c
· 99.4% identity |
|---|---|
| M. marinum |
MMAR_1664
· 77.2% identity |
| M. smegmatis |
MSMEG_1050
· 68.2% identity |
| M. orygis |
RJtmp_003140
· 100.0% identity |
| M. abscessus |
MAB_3380c
· 60.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJZ3
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Uncharacterized S-adenosylmethionine-dependent methyltransferase Rv3037c |
| EC (curated) |
EC 2.1.1.-
|
UniProt still lists this protein as Uncharacterized S-adenosylmethionine-dependent methyltransferase Rv3037c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| eggNOG description | DNA repair |
| Orthologous group | COG2263 |
| Gene Ontology (33) |
GO:0001510, GO:0003674, GO:0003824, GO:0006139, GO:0006396, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0008168, GO:0008173, GO:0009451 +21 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.679 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 3.03% of strains (4393) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.13 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 74.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 46.0% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 0.812, mean read count 119.692307692. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -1.01 | 0.003 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 5 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.89 ppm · rank 3293/3519 (6.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 358 aa |
|---|---|
| Molecular weight | 39.1 kDa |
| Theoretical pI | 9.45 |
| GRAVY | -0.123 (hydrophilic) |
| Aliphatic index | 100.3 |
| Aromaticity | 0.05 |
| Instability index | 49.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Thump_like | PF18096.7 | 3.3e-18 | 281–356 | THUMP domain-like |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3ll7-assembly1_A |
1.00 | 0.75 | 1.2e-19 sig | 3ll7-assembly1_A Crystal structure of putative methyltransferase PG_1098 from Porphyromonas gingivalis W83 |
6zxy-assembly1_B |
1.00 | 0.57 | 4.0e-06 sig | 6zxy-assembly1_B Structure of Archaeoglobus fulgidus Trm11 m2G10 tRNA methyltransferase enzyme |
6zxw-assembly1_G |
1.00 | 0.64 | 2.8e-05 sig | 6zxw-assembly1_G Structure of Archaeoglobus fulgidus Trm11-Trm112 m2G10 tRNA methyltransferase complex bound to sinefungin |
2jjq-assembly1_A |
1.00 | 0.61 | 1.5e-05 sig | 2jjq-assembly1_A The crystal structure of Pyrococcus abyssi tRNA (uracil-54, C5)- methyltransferase in complex with S-adenosyl-L-homocysteine |
1wy7-assembly1_A |
1.00 | 0.62 | 3.5e-05 sig | 1wy7-assembly1_A crystal structure of a putative RNA methyltransferase PH1948 from Pyrococcus horikoshii |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | TB22.2 (- strand, 72 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3038c (- strand, 134 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: serB2 (phosphoserine phosphatase SerB), medium confidence from genomic context alone (score 539 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3036c TB22.2 hyp |
hypothetical protein | 578 | 578 ctx | neighborhood:578 |
Rv3042c serB2 |
phosphoserine phosphatase SerB | 539 | 539 ctx | neighborhood:472 |
Rv2848c cobB |
cobyrinic acid A,C-diamide synthase | 514 | 514 | coexpression:514 |
Rv3038c hyp |
hypothetical protein | 646 | 504 ctx | neighborhood:493 |
Rv3438 hyp |
hypothetical protein | 494 | 494 ctx | cooccurence:494 |
Rv3041c |
ABC transporter ATP-binding protein | 492 | 493 ctx | neighborhood:490 |
Rv3753c hyp |
hypothetical protein | 492 | 493 ctx | cooccurence:490 |
Rv3039c echA17 |
enoyl-CoA hydratase EchA17 | 491 | 492 ctx | neighborhood:490 |
Rv3040c hyp |
hypothetical protein | 491 | 492 ctx | neighborhood:490 |
Rv2267c stf3 hyp |
hypothetical protein | 466 | 466 ctx | cooccurence:466 |
Rv3311 hyp |
hypothetical protein | 421 | 421 ctx | cooccurence:421 |
Rv2731 hyp |
hypothetical protein | 420 | 421 ctx | cooccurence:419 |
Rv3043c ctaD |
cytochrome C oxidase cytochrome 1 | 409 | 409 ctx | neighborhood:409 |
Rv2446c |
integral membrane protein | 408 | 409 ctx | cooccurence:405 |
Rv2135c hyp |
hypothetical protein | 521 | 191 | textmining:433 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): S-adenosylmethionine-dependent methyltransferase
- Pfam (hmmscan --cut_ga): Thump_like PF18096.7 (E=3e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217553.1)
- Domains: Pfam-A via hmmscan --cut_ga — Thump_like (PF18096.7)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2263 - Curated reference: UniProt P9WJZ3 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
serB2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3037c| MRARFGDRAPWLVETTLLRRRAAGKLGELCPNVGVSQWLFTDEALQQATAAPVARHRARRLAGRVVHDATCSIGTELAALRELAVRAVGSDIDPVRLAMARHNLAALGMEADLCRADVLHPVTRDAVVVIDPARRSNGRRRFHLADYQPGLGPLLDRYRGRDVVVKCAPGIDFEEVGRLGFEGEIEVISYRGGVREACLWSAGLAGSGIRRRASILDSGEQIGDDEPDDCGVRPAGKWIVDPDGAVVRAGLVRNYGARHGLWQLDPQIAYLSGDRLPPALRGFEVLEQLAFDERRLRQVLSALDCGAAEILVRGVAIDPDALRRRLRLRGSRPLAVVITRIGAGSLSHVTAYVCRPSR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3037c? Email the maintainer — the message is pre-filled with this gene's details.