Rv2811 Still unknown · low auto-curated
H37Rv Rv2811 · MTBC0 mtbc0_002991 ·
141 aa · 3138554–3139170 (+) ·
RefSeq NP_217327.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7av6-assembly1_A-2 FAST in a domain-swapped dimer form (prob 0.15, TM 0.36). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P71640
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| eggNOG description | Transposase |
| Orthologous group | COG3677 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 49.2 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7av6-assembly1_A-2 |
0.15 | 0.36 | 5.2e-01 | 7av6-assembly1_A-2 FAST in a domain-swapped dimer form |
9e7f-assembly1_BN |
0.14 | 0.38 | 6.3e-01 | 9e7f-assembly1_BN Cryo-EM structure of the Pyrobaculum calidifontis 70S ribosome in complex with Dri |
5xdz-assembly1_B |
0.11 | 0.42 | 1.4e+00 | 5xdz-assembly1_B Crystal structure of zebrafish SNX25 PX domain |
9axv-assembly1_Ad |
0.11 | 0.38 | 1.0e+00 | 9axv-assembly1_Ad Translating S. pombe ribosome |
6th6-assembly1_Ao |
0.11 | 0.39 | 1.0e+00 | 6th6-assembly1_Ao Cryo-EM Structure of T. kodakarensis 70S ribosome |
3rn2-assembly1_A |
0.11 | 0.60 | 3.9e+00 | 3rn2-assembly1_A Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors |
7mwz-assembly1_A |
0.11 | 0.43 | 1.4e+00 | 7mwz-assembly1_A Structure of drosophila STING in complex with 3'2'-cGAMP |
5opt-assembly1_M |
0.10 | 0.34 | 6.7e-01 | 5opt-assembly1_M Structure of KSRP in context of Trypanosoma cruzi 40S |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2812 (transposase), medium confidence from genomic context alone (score 635 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0689c hyp |
hypothetical protein | 732 | 732 | coexpression:732 |
Rv2812 |
transposase | 635 | 635 ctx | neighborhood:620 |
Rv2813 hyp |
hypothetical protein | 624 | 624 ctx | neighborhood:620 |
Rv2098c PE_PGRS36 |
PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub | 615 | 615 | coexpression:615 |
Rv2810c |
Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for | 576 | 576 ctx | neighborhood:573 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 7av6-assembly1_A-2 FAST in a domain-swapped dimer form (prob 0.15, E=5e-01, TM=0.36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217327.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3677 - Curated reference: UniProt P71640 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 49.2, very low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
5 functional partner(s); context anchor
Rv2812 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002991|Rv2811| MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTSGGGDRVGAGGEGHQPGRVPPDRHGCGSQYRRRRCGAGCAGLPSVSRRCGRCSRCGCARSMPIR