Rv2811 Still unknown · low auto-curated

H37Rv Rv2811 · MTBC0 mtbc0_002991 · 141 aa · 3138554–3139170 (+) · RefSeq NP_217327.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7av6-assembly1_A-2 FAST in a domain-swapped dimer form (prob 0.15, TM 0.36).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71640 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionTransposase
Orthologous groupCOG3677

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 49.2 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7av6-assembly1_A-2 0.15 0.36 5.2e-01 7av6-assembly1_A-2 FAST in a domain-swapped dimer form
9e7f-assembly1_BN 0.14 0.38 6.3e-01 9e7f-assembly1_BN Cryo-EM structure of the Pyrobaculum calidifontis 70S ribosome in complex with Dri
5xdz-assembly1_B 0.11 0.42 1.4e+00 5xdz-assembly1_B Crystal structure of zebrafish SNX25 PX domain
9axv-assembly1_Ad 0.11 0.38 1.0e+00 9axv-assembly1_Ad Translating S. pombe ribosome
6th6-assembly1_Ao 0.11 0.39 1.0e+00 6th6-assembly1_Ao Cryo-EM Structure of T. kodakarensis 70S ribosome
3rn2-assembly1_A 0.11 0.60 3.9e+00 3rn2-assembly1_A Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors
7mwz-assembly1_A 0.11 0.43 1.4e+00 7mwz-assembly1_A Structure of drosophila STING in complex with 3'2'-cGAMP
5opt-assembly1_M 0.10 0.34 6.7e-01 5opt-assembly1_M Structure of KSRP in context of Trypanosoma cruzi 40S

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2812 (transposase), medium confidence from genomic context alone (score 635 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0689c hyp hypothetical protein 732 732 coexpression:732
Rv2812 transposase 635 635 ctx neighborhood:620
Rv2813 hyp hypothetical protein 624 624 ctx neighborhood:620
Rv2098c PE_PGRS36 PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub 615 615 coexpression:615
Rv2810c Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for 576 576 ctx neighborhood:573

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7av6-assembly1_A-2 FAST in a domain-swapped dimer form (prob 0.15, E=5e-01, TM=0.36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217327.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3677
  • Curated reference: UniProt P71640 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 49.2, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor Rv2812
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002991|Rv2811|
MVTVEADVDQVERRLAAGELSCPSCGGVLAGWGRARSRQLRGPAGPVELCPRRSRCTGCGVTHVLLPVSALLRRADTSGGGDRVGAGGEGHQPGRVPPDRHGCGSQYRRRRCGAGCAGLPSVSRRCGRCSRCGCARSMPIR