Rv2813 Family assigned · medium auto-curated

H37Rv Rv2813 · MTBC0 mtbc0_002993 · 270 aa · 3140649–3141461 (+) · RefSeq NP_217329.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationExeA family protein
Revised (this work)ExeA family protein. Pfam: AAA_22 (PF13401.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XFD1 TrEMBL · unreviewed · Predicted
UniProt nameORC1/DEAH AAA+ ATPase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
eggNOG descriptionSMART AAA ATPase
Orthologous groupCOG3267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.526 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.27% of strains (389) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_22PF13401.13 1.1e-2044–173 AAA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2812 (transposase), high confidence from genomic context alone (score 977 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2812 transposase 977 977 ctx neighborhood:882 cooccurence:643
Rv3638 transposase 774 775 coexpression:772
Rv2811 hyp hypothetical protein 624 624 ctx neighborhood:620
Rv2810c Probable transposase; Rv2810c, (MTCY16B7.33), len: 133 aa. Probable transposase for IS1555, similar to C-terminal domain of transposases for 588 588 ctx neighborhood:451
Rv3859c gltB glutamate synthase large subunit 546 546 ctx neighborhood:544
Rv1755c plcD Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below),highly similar to C-terminus o 536 93 textmining:510
Rv3327 transposase fusion protein 811 90 textmining:801
Rv0197 oxidoreductase 812 87 textmining:803
Rv0796 Putative transposase for insertion sequence element IS6110; Involved in the transposition of the insertion sequence. 641 79 textmining:627
Rv2814c Probable transposase; Rv2814c, (MTCY16B7.29), len: 328 aa. Probable transposase subunit for IS6110. Identical to many other M. tuberculosis 874 77 textmining:870
Rv3212 hyp hypothetical protein 815 76 textmining:809
Rv2820c csm4 CRISPR type III-associated RAMP protein Csm4 527 71 textmining:512
Rv1777 cyp144 cytochrome P450 Cyp144 428 71 textmining:410
Rv0578c PE_PGRS7 PE-PGRS family protein PE_PGRS7 805 59 textmining:802
Rv0279c PE_PGRS4 PE-PGRS family protein PE_PGRS4 520 59 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: ExeA family protein
  • Pfam (hmmscan --cut_ga): AAA_22 PF13401.13 (E=1e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217329.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_22 (PF13401.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3267
  • Curated reference: UniProt I6XFD1 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor Rv2812
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002993|Rv2813|
MMHKLISYYGFSRMPFGRDLAPGMLHRHSAHNEAVARIGWCIADRRIGVITGEVGAGKTVAVRAALASLDRSRHTVIYLPDPTVGVQGIHHRIVASLGGQPLTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNHDLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDTNTGSYLRHHLKLAGRDDALFSDDAIGLIHQTSRGYPRAVNNLALQALVAAFAADKAIVDESTTRTAIAEVTAD