cysE Resolved · medium auto-curated

H37Rv Rv2335 · MTBC0 mtbc0_002485 · 229 aa · 2634482–2635171 (+) · RefSeq NP_216851.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)serine acetyltransferase
MTBC0 PGAP re-annotationserine O-acetyltransferase
Revised (this work)Serine O-acetyltransferase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95231 SwissProt · reviewed · Evidence at protein level
UniProt nameSerine acetyltransferase
EC (curated) EC 2.3.1.30
Curated functionCatalyzes the acetylation of serine by acetyl-CoA to produce O-acetylserine (OAS).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namecysE
eggNOG descriptionSerine acetyltransferase
Orthologous groupCOG1045
EC number EC 2.3.1.30
KEGG orthology K00640
KEGG pathways map00270, map00920, map01100, map01110, map01120, map01200, map01230, map05111
KEGG modules M00021
Gene Ontology (51) GO:0000096, GO:0000097, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006082, GO:0006520, GO:0006534 +39 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.909 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 8 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (150) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysK1 (O-acetylserine sulfhydrylase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2334 cysK1 O-acetylserine sulfhydrylase 999 1000 ctx neighborhood:882 cooccurence:726 coexpression:919 database:900 textmining:753
Rv3684 lyase 987 966 coexpression:477 database:900 textmining:646
Rv1077 cbs cystathionine beta-synthase 975 957 coexpression:481 database:800 textmining:461
Rv0069c sdaA L-serine dehydratase 956 901 database:900 textmining:579
Rv3580c cysS1 cysteine--tRNA ligase 920 855 ctx fusion:477 coexpression:718 textmining:479
Rv3042c serB2 phosphoserine phosphatase SerB 907 809 database:800 textmining:534
Rv1559 ilvA threonine dehydratase IlvA 822 809 database:800
Rv0436c pssA CDP-diacylglycerol--serine O-phosphatidyltransferase 809 809 database:800
Rv1093 glyA1 serine hydroxymethyltransferase 897 805 database:800 textmining:493
Rv1612 trpB tryptophan synthase subunit beta 819 805 database:800
Rv1613 trpA tryptophan synthase subunit alpha 819 804 database:800
Rv1294 thrA homoserine dehydrogenase 823 803 database:800
Rv1296 thrB homoserine kinase 830 802 database:800
Rv0070c glyA2 serine hydroxymethyltransferase 885 800 database:800 textmining:451
Rv1336 cysM O-phosphoserine sulfhydrylase 947 795 coexpression:495 textmining:753

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: serine acetyltransferase
  • MTBC0 PGAP product: serine O-acetyltransferase
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216851.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1045
  • Curated reference: UniProt P95231 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor cysK1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002485|Rv2335|cysE
MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFTRILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTVGDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFDWRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI