cysE Resolved · medium auto-curated
H37Rv Rv2335 · MTBC0 mtbc0_002485 ·
229 aa · 2634482–2635171 (+) ·
RefSeq NP_216851.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | serine acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | serine O-acetyltransferase |
| Revised (this work) | Serine O-acetyltransferase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P95231
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Serine acetyltransferase |
| EC (curated) |
EC 2.3.1.30
|
| Curated function | Catalyzes the acetylation of serine by acetyl-CoA to produce O-acetylserine (OAS). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | cysE |
| eggNOG description | Serine acetyltransferase |
| Orthologous group | COG1045 |
| EC number |
EC 2.3.1.30
|
| KEGG orthology |
K00640
|
| KEGG pathways |
map00270, map00920, map01100, map01110, map01120, map01200, map01230, map05111
|
| KEGG modules |
M00021
|
| Gene Ontology (51) |
GO:0000096, GO:0000097, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006082, GO:0006520, GO:0006534 +39 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.909 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 8 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (150) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cysK1 (O-acetylserine sulfhydrylase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2334 cysK1 |
O-acetylserine sulfhydrylase | 999 | 1000 ctx | neighborhood:882 cooccurence:726 coexpression:919 database:900 textmining:753 |
Rv3684 |
lyase | 987 | 966 | coexpression:477 database:900 textmining:646 |
Rv1077 cbs |
cystathionine beta-synthase | 975 | 957 | coexpression:481 database:800 textmining:461 |
Rv0069c sdaA |
L-serine dehydratase | 956 | 901 | database:900 textmining:579 |
Rv3580c cysS1 |
cysteine--tRNA ligase | 920 | 855 ctx | fusion:477 coexpression:718 textmining:479 |
Rv3042c serB2 |
phosphoserine phosphatase SerB | 907 | 809 | database:800 textmining:534 |
Rv1559 ilvA |
threonine dehydratase IlvA | 822 | 809 | database:800 |
Rv0436c pssA |
CDP-diacylglycerol--serine O-phosphatidyltransferase | 809 | 809 | database:800 |
Rv1093 glyA1 |
serine hydroxymethyltransferase | 897 | 805 | database:800 textmining:493 |
Rv1612 trpB |
tryptophan synthase subunit beta | 819 | 805 | database:800 |
Rv1613 trpA |
tryptophan synthase subunit alpha | 819 | 804 | database:800 |
Rv1294 thrA |
homoserine dehydrogenase | 823 | 803 | database:800 |
Rv1296 thrB |
homoserine kinase | 830 | 802 | database:800 |
Rv0070c glyA2 |
serine hydroxymethyltransferase | 885 | 800 | database:800 textmining:451 |
Rv1336 cysM |
O-phosphoserine sulfhydrylase | 947 | 795 | coexpression:495 textmining:753 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: serine acetyltransferase
- MTBC0 PGAP product: serine O-acetyltransferase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216851.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1045 - Curated reference: UniProt P95231 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
cysK1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002485|Rv2335|cysE MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFTRILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTVGDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFDWRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI