Rv2970A Still unknown · low auto-curated
H37Rv Rv2970A · MTBC0 - ·
56 aa · 3325934–3326104 (+) ·
RefSeq YP_177681.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6XFT2
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | dkgA |
| eggNOG description | aldo-keto reductase (NADP) activity |
| Orthologous group | COG0656 |
| EC number |
EC 1.1.1.346
|
| KEGG orthology |
K06221
|
| Gene Ontology (32) |
GO:0003674, GO:0003824, GO:0004033, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006081, GO:0008106, GO:0008150, GO:0008152 +20 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2971 (oxidoreductase), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2971 |
oxidoreductase | 889 | 889 ctx | neighborhood:881 |
Rv2970c lipN |
lipase/esterase LipN | 769 | 765 ctx | neighborhood:748 |
Rv2124c metH |
methionine synthase | 745 | 714 | database:630 |
Rv2969c hyp |
hypothetical protein | 660 | 660 ctx | neighborhood:652 |
Rv2968c |
integral membrane protein | 641 | 642 ctx | neighborhood:640 |
Rv2298 |
oxidoreductase | 570 | 513 | coexpression:417 |
Rv2006 otsB1 |
trehalose-6-phosphate phosphatase OtsB | 533 | 507 | coexpression:504 |
Rv0432 sodC |
superoxide dismutase | 532 | 503 | coexpression:447 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 621 | 498 | coexpression:413 |
Rv1597 hyp |
hypothetical protein | 497 | 497 ctx | cooccurence:494 |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 619 | 496 | coexpression:410 |
Rv2048c pks12 |
polyketide synthase | 618 | 493 | coexpression:407 |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 618 | 493 | coexpression:407 |
Rv1527c pks5 |
polyketide synthase | 617 | 492 | coexpression:406 |
Rv3372 otsB2 |
trehalose 6-phosphate phosphatase | 513 | 484 | coexpression:484 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177681.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0656 - Curated reference: UniProt I6XFT2 (TrEMBL, unreviewed; Predicted)
- Model confidence: ESMFold per-residue pLDDT (mean 47.0, very low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
Rv2971 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2970A| MLIRWHIQLGNIVIPKSVNPMRIASNFDAFDFPRSMTEPGLVRIRKPSISQAGEMT