Rv2970A Still unknown · low auto-curated

H37Rv Rv2970A · MTBC0 - · 56 aa · 3325934–3326104 (+) · RefSeq YP_177681.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6XFT2 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namedkgA
eggNOG descriptionaldo-keto reductase (NADP) activity
Orthologous groupCOG0656
EC number EC 1.1.1.346
KEGG orthology K06221
Gene Ontology (32) GO:0003674, GO:0003824, GO:0004033, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006081, GO:0008106, GO:0008150, GO:0008152 +20 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2971 (oxidoreductase), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2971 oxidoreductase 889 889 ctx neighborhood:881
Rv2970c lipN lipase/esterase LipN 769 765 ctx neighborhood:748
Rv2124c metH methionine synthase 745 714 database:630
Rv2969c hyp hypothetical protein 660 660 ctx neighborhood:652
Rv2968c integral membrane protein 641 642 ctx neighborhood:640
Rv2298 oxidoreductase 570 513 coexpression:417
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 533 507 coexpression:504
Rv0432 sodC superoxide dismutase 532 503 coexpression:447
Rv2940c mas multifunctional mycocerosic acid synthase 621 498 coexpression:413
Rv1597 hyp hypothetical protein 497 497 ctx cooccurence:494
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 619 496 coexpression:410
Rv2048c pks12 polyketide synthase 618 493 coexpression:407
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 618 493 coexpression:407
Rv1527c pks5 polyketide synthase 617 492 coexpression:406
Rv3372 otsB2 trehalose 6-phosphate phosphatase 513 484 coexpression:484

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177681.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0656
  • Curated reference: UniProt I6XFT2 (TrEMBL, unreviewed; Predicted)
  • Model confidence: ESMFold per-residue pLDDT (mean 47.0, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor Rv2971
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2970A|
MLIRWHIQLGNIVIPKSVNPMRIASNFDAFDFPRSMTEPGLVRIRKPSISQAGEMT