Rv2260 Resolved · high auto-curated

H37Rv Rv2260 · MTBC0 mtbc0_002403 · 211 aa · 2559437–2560072 (+) · RefSeq NP_216776.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMBL fold metallo-hydrolase
Revised (this work)MBL fold metallo-hydrolase. Pfam: Lactamase_B (PF00753.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53534 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMetallo-beta-lactamase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionMetallo-beta-lactamase superfamily
Orthologous groupCOG0491

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.687 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Lactamase_BPF00753.34 8.2e-2223–190 Metallo-beta-lactamase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mscR (S-nitrosomycothiol reductase MscR), high confidence from genomic context alone (score 958 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2259 mscR S-nitrosomycothiol reductase MscR 959 958 ctx neighborhood:882 cooccurence:633
Rv2258c transcriptional regulator 705 705 ctx neighborhood:692
Rv2257c hyp hypothetical protein 704 695 ctx neighborhood:689
Rv0360c hyp hypothetical protein 649 650 ctx cooccurence:648
Rv2256c hyp hypothetical protein 645 645 ctx neighborhood:644
Rv0331 dehydrogenase/reductase 651 636 database:583
Rv1117 hyp hypothetical protein 519 520 ctx cooccurence:509
Rv3677c beta lactamase 462 463 ctx cooccurence:456
Rv2643 arsC arsenic-transport integral membrane protein ArsC 445 429
Rv3455c truA tRNA pseudouridine synthase A 419 397
Rv2367c ybeY endoribonuclease 424 396

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MBL fold metallo-hydrolase
  • Pfam (hmmscan --cut_ga): Lactamase_B PF00753.34 (E=8e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216776.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Lactamase_B (PF00753.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0491
  • Curated reference: UniProt O53534 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor mscR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002403|Rv2260|
MAAIERVITHGTFELDGGSWEVDNNIWLVGDDSEVVVFDAAHHAAPIIDAVGGRKVVAVICTHGHNDHVTVAPELGTALDAPVLMHPGDAVLWRMTHPDKSFRAVSDGDAVRVGGTELRALHTPGHSPGSVCWYAPELGPGTGTVFSGDTLFAGGPGATGRSYSDFPTILRSISGRLGALPGDTVVHTGHGDSTTIGDEIVHYEEWVARGH