acpM Resolved · high auto-curated
H37Rv Rv2244 · MTBC0 mtbc0_002386 ·
115 aa · 2543929–2544276 (+) ·
RefSeq NP_216760.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | meromycolate extension acyl carrier protein |
|---|---|
| MTBC0 PGAP re-annotation | meromycolate extension acyl carrier protein AcpM |
| Revised (this work) | Meromycolate extension acyl carrier protein AcpM. Pfam: PP-binding (PF00550.32). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQF3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Meromycolate extension acyl carrier protein |
| Curated function | Acyl carrier protein involved in meromycolate extension. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolismQ Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | acpP |
| eggNOG description | Carrier of the growing fatty acid chain in fatty acid biosynthesis |
| Orthologous group | COG0236 |
| KEGG orthology |
K02078
|
| Gene Ontology (97) |
GO:0000035, GO:0000036, GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0005975 +85 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.302 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PP-binding | PF00550.32 | 1.4e-17 | 12–77 | Phosphopantetheine attachment site |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: kasA (3-oxoacyl-ACP synthase 1), high confidence from genomic context alone (score 989 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3795 embB |
arabinosyltransferase B | 999 | 999 | experimental:999 |
Rv3793 embC |
arabinosyltransferase C | 997 | 997 | experimental:997 |
Rv2245 kasA |
3-oxoacyl-ACP synthase 1 | 999 | 989 ctx | neighborhood:882 coexpression:810 experimental:408 textmining:946 |
Rv3794 embA |
arabinosyltransferase A | 986 | 986 | experimental:986 |
Rv2524c fas |
fatty acid synthase | 989 | 984 | coexpression:648 experimental:895 database:549 |
Rv2243 fabD |
malonyl CoA-acyl carrier protein transacylase | 998 | 978 ctx | neighborhood:788 cooccurence:413 coexpression:438 experimental:422 database:549 textmining:921 |
Rv2246 kasB |
3-oxoacyl-ACP synthase 2 | 996 | 956 ctx | neighborhood:836 coexpression:463 experimental:408 textmining:929 |
Rv1344 mbtL |
acyl carrier protein MbtL | 908 | 900 | database:900 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 856 | 851 | coexpression:428 experimental:449 database:564 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 871 | 846 | coexpression:410 experimental:449 database:564 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 852 | 845 | coexpression:405 experimental:449 database:564 |
Rv2247 accD6 |
acetyl-/propionyl-CoA carboxylase subunit beta | 954 | 837 ctx | neighborhood:798 textmining:734 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 835 | 831 | coexpression:411 experimental:449 database:518 |
Rv0310c hyp |
hypothetical protein | 816 | 808 | experimental:449 database:561 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 793 | 784 | experimental:449 database:564 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: meromycolate extension acyl carrier protein
- MTBC0 PGAP product: meromycolate extension acyl carrier protein AcpM
- Pfam (hmmscan --cut_ga): PP-binding PF00550.32 (E=1e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216760.1)
- Domains: Pfam-A via hmmscan --cut_ga — PP-binding (PF00550.32)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0236 - Curated reference: UniProt P9WQF3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
171 functional partner(s); context anchor
kasA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002386|Rv2244|acpM MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK