acpM Resolved · high auto-curated

H37Rv Rv2244 · MTBC0 mtbc0_002386 · 115 aa · 2543929–2544276 (+) · RefSeq NP_216760.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)meromycolate extension acyl carrier protein
MTBC0 PGAP re-annotationmeromycolate extension acyl carrier protein AcpM
Revised (this work)Meromycolate extension acyl carrier protein AcpM. Pfam: PP-binding (PF00550.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQF3 SwissProt · reviewed · Evidence at protein level
UniProt nameMeromycolate extension acyl carrier protein
Curated functionAcyl carrier protein involved in meromycolate extension.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
Preferred nameacpP
eggNOG descriptionCarrier of the growing fatty acid chain in fatty acid biosynthesis
Orthologous groupCOG0236
KEGG orthology K02078
Gene Ontology (97) GO:0000035, GO:0000036, GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0005975 +85 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.302 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PP-bindingPF00550.32 1.4e-1712–77 Phosphopantetheine attachment site

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: kasA (3-oxoacyl-ACP synthase 1), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3795 embB arabinosyltransferase B 999 999 experimental:999
Rv3793 embC arabinosyltransferase C 997 997 experimental:997
Rv2245 kasA 3-oxoacyl-ACP synthase 1 999 989 ctx neighborhood:882 coexpression:810 experimental:408 textmining:946
Rv3794 embA arabinosyltransferase A 986 986 experimental:986
Rv2524c fas fatty acid synthase 989 984 coexpression:648 experimental:895 database:549
Rv2243 fabD malonyl CoA-acyl carrier protein transacylase 998 978 ctx neighborhood:788 cooccurence:413 coexpression:438 experimental:422 database:549 textmining:921
Rv2246 kasB 3-oxoacyl-ACP synthase 2 996 956 ctx neighborhood:836 coexpression:463 experimental:408 textmining:929
Rv1344 mbtL acyl carrier protein MbtL 908 900 database:900
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 856 851 coexpression:428 experimental:449 database:564
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 871 846 coexpression:410 experimental:449 database:564
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 852 845 coexpression:405 experimental:449 database:564
Rv2247 accD6 acetyl-/propionyl-CoA carboxylase subunit beta 954 837 ctx neighborhood:798 textmining:734
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 835 831 coexpression:411 experimental:449 database:518
Rv0310c hyp hypothetical protein 816 808 experimental:449 database:561
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 793 784 experimental:449 database:564

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: meromycolate extension acyl carrier protein
  • MTBC0 PGAP product: meromycolate extension acyl carrier protein AcpM
  • Pfam (hmmscan --cut_ga): PP-binding PF00550.32 (E=1e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216760.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PP-binding (PF00550.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0236
  • Curated reference: UniProt P9WQF3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 171 functional partner(s); context anchor kasA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002386|Rv2244|acpM
MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK