Rv1804c Resolved · medium

H37Rv Rv1804c · MTBC0 mtbc0_001917 · 108 aa · 2065034–2065360 (-) · RefSeq NP_216320.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF732 domain-containing protein
Revised (this work)Secreted protein that activates macrophage pro-inflammatory responses by binding the host IkappaB-alpha PEST domain. RefSeq leaves it 'hypothetical'. Highly conserved secretory Rv1804c directly interacts with the PEST domain of IkappaB-alpha, activating it in an IKKalpha-independent manner; it inhibits mycobacterial survival and is enriched in attenuated rather than virulent strains (Zheng 2024). Also an antibody-eliciting antigen in active TB (Ben Amor 2005).

Curated reference (UniProt)

UniProt O53953 TrEMBL · unreviewed · Predicted
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF732)
Orthologous group2B16Q

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF732PF05305.20 1.0e-1727–97 Protein of unknown function (DUF732)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 71.5 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3lcn-assembly2_B 0.21 0.48 2.4e+00 3lcn-assembly2_B Nab2:Gfd1 complex
2gtg-assembly1_A 0.14 0.44 3.2e+00 2gtg-assembly1_A Crystal Structure of Human Saposin C
4a8e-assembly1_A-2 0.10 0.43 6.1e+00 4a8e-assembly1_A-2 The structure of a dimeric Xer recombinase from archaea
2k48-assembly1_A 0.03 0.22 6.8e+00 2k48-assembly1_A NMR Structure of the N-terminal Coiled Coil Domain of the Andes Hantavirus Nucleocapsid Protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE_PGRS32 (PE-PGRS family protein PE_PGRS32), medium confidence from genomic context alone (score 461 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1803c PE_PGRS32 PE-PGRS family protein PE_PGRS32 460 461 ctx neighborhood:461
Rv1805c hyp hypothetical protein 418 419 ctx neighborhood:415
Rv0603 hyp hypothetical protein 871 53 textmining:870
Rv2253 hyp hypothetical protein 870 47 textmining:870
Rv0203 hyp hypothetical protein 696 41 textmining:696
Rv0934 pstS1 phosphate ABC transporter substrate-binding lipoprotein PstS 511 41 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Secreted; binds IkappaB-alpha PEST domain, activates pro-inflammatory response (Zheng 2024, PMID 38384838)
  • Antibody-eliciting secreted antigen (Ben Amor 2005, PMID 15683450)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216320.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B16Q
  • Curated reference: UniProt O53953 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 71.5, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor PE_PGRS32
  • Primary literature: Zheng J, Dong C, Xiong S (2024). Mycobacterial Rv1804c binds to the PEST domain of IkappaBalpha and activates macrophage-mediated proinflammatory responses iScience 27(3):109101. doi:10.1016/j.isci.2024.109101 PMID:38384838

Ancestral MTBC0 protein sequence

>mtbc0_001917|Rv1804c|
MRVVSTLLSIPLMIGLAVPAHAGPSGDDAVFLASLERAGITYSHPDQAIASGKAVCALVESGESGLQVVNELRTRNPGFSMDGCCKFAAISAHVYCPHQITKTSVSAK