Rv2265 Resolved · high auto-curated

H37Rv Rv2265 · MTBC0 mtbc0_002407 · 409 aa · 2564805–2566034 (+) · RefSeq NP_216781.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationMFS transporter
Revised (this work)MFS transporter. Pfam: MFS_1 (PF07690.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLG3 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2265

UniProt still lists this protein as Uncharacterized protein Rv2265; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
G Carbohydrate transport and metabolism
P Inorganic ion transport and metabolism
eggNOG descriptionMajor Facilitator Superfamily
Orthologous groupCOG0477

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.388 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MFS_1PF07690.22 7.3e-1442–298 Major Facilitator Superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp124 (cytochrome P450 Cyp124), medium confidence from genomic context alone (score 479 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2266 cyp124 cytochrome P450 Cyp124 478 479 ctx neighborhood:476
Rv1747 ABC transporter ATP-binding protein/permease 499 72 textmining:483
Rv3640c transposase 438 54 textmining:431
Rv1999c transporter 674 50 textmining:671
Rv1382 hyp hypothetical protein 808 47 textmining:807
Rv0046c ino1 inositol-3-phosphate synthase 439 41 textmining:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: MFS transporter
  • Pfam (hmmscan --cut_ga): MFS_1 PF07690.22 (E=7e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216781.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MFS_1 (PF07690.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0477
  • Curated reference: UniProt P9WLG3 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor cyp124
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002407|Rv2265|
MGANGDVALSRIGATRPALSAWRFVTVFGVVGLLADVVYEGARSITGPLLASLGATGLVVGVVTGVGEAAALGLRLVSGPLADRSRRFWAWTIAGYTLTVVTVPLLGIAGALWVACALVIAERVGKAVRGPAKDTLLSHAASVTGRGRGFAVHEALDQVGAMIGPLTVAGMLAITGNAYAPALGVLTLPGGAALALLLWLQRRVPRPESYEDCPVVLGNPSAPRPWALPAQFWLYCGFTAITMLGFGTFGLLSFHMVSHGVLAAAMVPVVYAAAMAADALTALASGFSYDRYGAKTLAVLPILSILVVLFAFTDNVTMVVIGTLVWGAAVGIQESTLRGVVADLVASPRRASAYGVFAAGLGAATAGGGALIGWLYDISIGTLVVVVIALELMALVMMFAIRLPRVAPS