ggtA Resolved · high auto-curated

H37Rv Rv0773c · MTBC0 - · 512 aa · 865851–867389 (-) · RefSeq NP_215287.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase
MTBC0 PGAP re-annotation
Revised (this work)Bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase. Pfam: G_glu_transpept (PF01019.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X9S5 TrEMBL · unreviewed · Evidence at protein level
UniProt nameGlutathione hydrolase proenzyme
EC (curated) EC 2.3.2.2, EC 3.4.19.13

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameggtA
eggNOG descriptiongamma-glutamyltransferase
Orthologous groupCOG0405
EC number EC 2.3.2.2, EC 3.4.19.13
KEGG orthology K00681
KEGG pathways map00430, map00460, map00480, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.674 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (224) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
G_glu_transpeptPF01019.28 2.5e-17516–511 Gamma-glutamyltranspeptidase

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2394 ggtB gamma-glutamyltranspeptidase precursor GgtB 925 925 database:900
Rv0266c oplA 5-oxoprolinase OplA 925 921 database:900
Rv2213 pepB cytosol aminopeptidase 928 919 database:900
Rv0433 carboxylate-amine ligase 932 909 database:900
Rv2467 pepN aminopeptidase PepN 907 902 database:900
Rv3432c gadB glutamate decarboxylase GadB 911 901 database:900
Rv3704c gshA glutamate--cysteine ligase 900 901 database:900
Rv0788 purQ phosphoribosylformylglycinamidine synthase 808 808 database:800
Rv2476c gdh NAD-dependent glutamate dehydrogenase 805 805 database:800
Rv1187 rocA pyrroline-5-carboxylate dehydrogenase RocA 811 804 database:800
Rv2220 glnA1 glutamine synthetase 863 803 database:800
Rv2860c glnA4 glutamine synthetase 852 803 database:800
Rv2222c glnA2 glutamine synthetase 850 803 database:800
Rv3858c gltD glutamate synthase small subunit 810 803 database:800
Rv3859c gltB glutamate synthase large subunit 858 802 database:800

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase
  • Pfam (hmmscan --cut_ga): G_glu_transpept PF01019.28 (E=2e-175)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215287.1)
  • Domains: Pfam-A via hmmscan --cut_ga — G_glu_transpept (PF01019.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0405
  • Curated reference: UniProt I6X9S5 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0773c|ggtA
MPILATNVVCTSQPLAAQAGLRMLADGGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVWDGQKLHGLNASGRSPSAWTPEYFGGNAVPVLGWNSVTVPGAVSAWVELHARFGRLPFETLFEPAISYGRNGFLVSPTVAAQWAAQVPLFASQPGFADAFMPGGRAPKPGELFTFPDHAATLEKIAATNGEEFYRGELAAKLEAHSAANGGVMRADDLAAHRVDWVDTITGTYRGYTIHQIPPNGQGIVALIALGILEHFDMSSWSVDSAESVHVQIEALKLAFADAQACVADIDYMPVHPKRLLDKEYLRQRATLIDPKRAMPAATGIPRGGTVYLAAADAAGMMVSMIQSNYLGFGSGVVVPGTGISLHNRGSDFTVVPRHPNRVGPRKRPYHTIIPGFVTRDGAPVMSFGVMGGMMQPQGHVQVLVRIADYGQNPQAACDGPRFRWVNGMRVSFENGFPDSTLDELRQRGHDLVAVADYSQFGSCQAIWRLDDGYLAASDPRRDGQAAAC