ggtA Resolved · high auto-curated
H37Rv Rv0773c · MTBC0 - ·
512 aa · 865851–867389 (-) ·
RefSeq NP_215287.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase. Pfam: G_glu_transpept (PF01019.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6X9S5
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glutathione hydrolase proenzyme |
| EC (curated) |
EC 2.3.2.2, EC 3.4.19.13
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | ggtA |
| eggNOG description | gamma-glutamyltransferase |
| Orthologous group | COG0405 |
| EC number |
EC 2.3.2.2, EC 3.4.19.13
|
| KEGG orthology |
K00681
|
| KEGG pathways |
map00430, map00460, map00480, map01100
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.674 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 5 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (224) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
G_glu_transpept | PF01019.28 | 2.5e-175 | 16–511 | Gamma-glutamyltranspeptidase |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2394 ggtB |
gamma-glutamyltranspeptidase precursor GgtB | 925 | 925 | database:900 |
Rv0266c oplA |
5-oxoprolinase OplA | 925 | 921 | database:900 |
Rv2213 pepB |
cytosol aminopeptidase | 928 | 919 | database:900 |
Rv0433 |
carboxylate-amine ligase | 932 | 909 | database:900 |
Rv2467 pepN |
aminopeptidase PepN | 907 | 902 | database:900 |
Rv3432c gadB |
glutamate decarboxylase GadB | 911 | 901 | database:900 |
Rv3704c gshA |
glutamate--cysteine ligase | 900 | 901 | database:900 |
Rv0788 purQ |
phosphoribosylformylglycinamidine synthase | 808 | 808 | database:800 |
Rv2476c gdh |
NAD-dependent glutamate dehydrogenase | 805 | 805 | database:800 |
Rv1187 rocA |
pyrroline-5-carboxylate dehydrogenase RocA | 811 | 804 | database:800 |
Rv2220 glnA1 |
glutamine synthetase | 863 | 803 | database:800 |
Rv2860c glnA4 |
glutamine synthetase | 852 | 803 | database:800 |
Rv2222c glnA2 |
glutamine synthetase | 850 | 803 | database:800 |
Rv3858c gltD |
glutamate synthase small subunit | 810 | 803 | database:800 |
Rv3859c gltB |
glutamate synthase large subunit | 858 | 802 | database:800 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase
- Pfam (hmmscan --cut_ga): G_glu_transpept PF01019.28 (E=2e-175)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215287.1)
- Domains: Pfam-A via hmmscan --cut_ga — G_glu_transpept (PF01019.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0405 - Curated reference: UniProt I6X9S5 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0773c|ggtA MPILATNVVCTSQPLAAQAGLRMLADGGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVWDGQKLHGLNASGRSPSAWTPEYFGGNAVPVLGWNSVTVPGAVSAWVELHARFGRLPFETLFEPAISYGRNGFLVSPTVAAQWAAQVPLFASQPGFADAFMPGGRAPKPGELFTFPDHAATLEKIAATNGEEFYRGELAAKLEAHSAANGGVMRADDLAAHRVDWVDTITGTYRGYTIHQIPPNGQGIVALIALGILEHFDMSSWSVDSAESVHVQIEALKLAFADAQACVADIDYMPVHPKRLLDKEYLRQRATLIDPKRAMPAATGIPRGGTVYLAAADAAGMMVSMIQSNYLGFGSGVVVPGTGISLHNRGSDFTVVPRHPNRVGPRKRPYHTIIPGFVTRDGAPVMSFGVMGGMMQPQGHVQVLVRIADYGQNPQAACDGPRFRWVNGMRVSFENGFPDSTLDELRQRGHDLVAVADYSQFGSCQAIWRLDDGYLAASDPRRDGQAAAC