Rv2205c Resolved · high auto-curated

H37Rv Rv2205c · MTBC0 mtbc0_002341 · 358 aa · 2495544–2496620 (-) · RefSeq NP_216721.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationglycerate kinase
Revised (this work)Glycerate kinase. Pfam: Gly_kinase (PF02595.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMT7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2205c

UniProt still lists this protein as Uncharacterized protein Rv2205c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred nameglxK
eggNOG descriptionBelongs to the glycerate kinase type-1 family
Orthologous groupCOG1929
EC number EC 2.7.1.165
KEGG orthology K00865
KEGG pathways map00260, map00561, map00630, map01100, map01120, map01130
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.666 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 1.11% of strains (1608) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Gly_kinasePF02595.21 2.2e-54155–348 Glycerate kinase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2206 (transmembrane protein), high confidence from genomic context alone (score 770 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0768 aldA aldehyde dehydrogenase AldA 906 903 database:900
Rv0147 aldehyde dehydrogenase 906 903 database:900
Rv0223c aldehyde dehydrogenase 906 903 database:900
Rv3293 pcd piperideine-6-carboxylic acid dehydrogenase 906 902 database:900
Rv0489 gpm1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 905 900 database:900
Rv2204c hyp hypothetical protein 774 774 ctx neighborhood:773
Rv2206 transmembrane protein 770 770 ctx neighborhood:769
Rv2208 cobS adenosylcobinamide-GDP ribazoletransferase 721 711 ctx neighborhood:709
Rv2207 cobT nicotinate-nucleotide-dimethylbenzimidazol phosphoribosyltransferase 710 710 ctx neighborhood:709
Rv3752c tadA cytidine/deoxycytidylate deaminase 630 630 ctx fusion:610
Rv1088 PE9 PE family protein PE9 414 415 coexpression:415
Rv0639 nusG transcription termination/antitermination protein NusG 418 41 textmining:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: glycerate kinase
  • Pfam (hmmscan --cut_ga): Gly_kinase PF02595.21 (E=2e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216721.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Gly_kinase (PF02595.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1929
  • Curated reference: UniProt P9WMT7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv2206
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002341|Rv2205c|
MRVLVAPDCYGDSLSAVEAAAAIATGWTRSRPGDSFIVAPQSDGGPGFVEVLGSRLGETRRLRVCGPLNTVVNAAWVFDPGSATAYLECAQACGLGLLGGPPTPETALAAHSKGVGQLIAAALRAGAARIVVGLGGSACTDGGKGMIAELGGLDAARRQLADVEVIAASDVEYPLLGPWGTARVFAPQKGADMATVAVLEGRLAAWAIELDAAAGRGVSAEPGAGAAGGIGAGLLAVGGRYQSGAAIIAEHTHFADDLADAELIVTGEGRFDEQSLHGKVVGAIAAAARPLAIPVIVLAGQVSLDKSALRSAGIMAALSIAEYAGSVRLALADAANQLMGLASQVAARLGNSGPSGYR