Rv0480c Family assigned · medium auto-curated

H37Rv Rv0480c · MTBC0 mtbc0_000505 · 280 aa · 572329–573171 MTBC0 (-) · RefSeq NP_214994.2

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)amidohydrolase
MTBC0 PGAP re-annotationcarbon-nitrogen hydrolase family protein
Revised (this work)Carbon-nitrogen hydrolase family protein. Pfam: CN_hydrolase (PF00795.28).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourRv0479c (Rv0479c, - strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.86 (95% CI -0.53 to 3.27). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; hydrolytic enzyme probably involved in cellular metabolism.
Mycobrowser EC 3.5.-.- · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0490c · 100.0% identity
M. leprae ML2449 · 81.9% identity
M. marinum MMAR_0805 · 78.9% identity
M. smegmatis MSMEG_0924 · 66.0% identity
M. orygis RJtmp_000504 · 100.0% identity
M. abscessus MAB_4076 · 61.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WJ01 SwissProt · reviewed · Evidence at protein level
UniProt nameHydrolase Rv0480c
EC (curated) EC 3.5.-.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionNitrilase cyanide hydratase and apolipoprotein N-acyltransferase
Orthologous groupCOG0388
KEGG orthology K11206
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.374 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 78.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 47.8%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 0.938, mean read count 147.066666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call

Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (Carbon-nitrogen hydrolase family protein. Pfam: CN_hydrolase (PF00795.28).), which was derived independently from structure and orthology.

Source annotationRv0480c Hydrolase Rv0480c (intermediary metabolism & respiration)
Covalent-inhibitor competition1.64× (probe labelling blocked by a serine-hydrolase inhibitor)

experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance244.0 ppm · rank 752/3519 (78.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length280 aa
Molecular weight29.0 kDa
Theoretical pI6.31
GRAVY0.117 (hydrophobic)
Aliphatic index93.8
Aromaticity0.054
Instability index31.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CN_hydrolasePF00795.28 1.7e-412–258 Carbon-nitrogen hydrolase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.7

PDB hitprobTM-scoreE-valueDescription
2w1v-assembly1_B 1.00 0.86 9.7e-26 sig 2w1v-assembly1_B Crystal structure of mouse nitrilase-2 at 1.4A resolution
1j31-assembly2_D 1.00 0.86 4.7e-22 sig 1j31-assembly2_D Crystal Structure of Hypothetical Protein PH0642 from Pyrococcus horikoshii
4izu-assembly1_A-2 1.00 0.83 9.2e-23 sig 4izu-assembly1_A-2 The E41Q mutant of the amidase from Nesterenkonia sp. AN1 showing the result of Michael addition of acrylamide at the active site cysteine
3iw3-assembly1_B 1.00 0.82 6.0e-22 sig 3iw3-assembly1_B Crystal structure of hyperthermophilic nitrilase
4hg3-assembly2_D 1.00 0.82 4.4e-22 sig 4hg3-assembly2_D Structural insights into yeast Nit2: wild-type yeast Nit2 in complex with alpha-ketoglutarate

Foldseek search of the AlphaFold DB model (mean pLDDT 93.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv0479c (- strand, -4 bp gap)
Downstream (3' on genome)Rv0481c (- strand, 181 bp gap)
Predicted operon Rv0479c · Rv0480c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0479c (membrane protein), high confidence from genomic context alone (score 882 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0479c membrane protein 882 882 ctx neighborhood:881
Rv0481c hyp hypothetical protein 744 745 ctx neighborhood:741
Rv0482 murB UDP-N-acetylenolpyruvoylglucosamine reductase 695 695 ctx neighborhood:691
Rv0483 lprQ lipoprotein LprQ 667 667 ctx neighborhood:661
Rv3068c pgmA exp phosphoglucomutase PgmA 618 599 database:544
Rv3339c icd1 exp isocitrate dehydrogenase 567 568 database:549
Rv2089c pepE exp dipeptidase PepE 559 559 database:497
Rv2535c pepQ exp cytoplasmic peptidase PepQ 558 558 database:497
Rv3315c cdd exp cytidine deaminase 576 556 database:522
Rv2365c hyp exp hypothetical protein 575 555 database:522
Rv2467 pepN exp aminopeptidase PepN 551 550 database:486
Rv2189c hyp exp hypothetical protein 551 549 database:486
Rv0331 dehydrogenase/reductase 466 438 coexpression:438
Rv1248c kgd exp multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 469 435 database:427
Rv0914c lipid carrier protein or keto acyl-CoA thiolase 453 432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: amidohydrolase
  • MTBC0 PGAP product: carbon-nitrogen hydrolase family protein
  • Pfam (hmmscan --cut_ga): CN_hydrolase PF00795.28 (E=2e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214994.2)
  • Domains: Pfam-A via hmmscan --cut_ga — CN_hydrolase (PF00795.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0388
  • Curated reference: UniProt P9WJ01 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor Rv0479c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000505|Rv0480c|
MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG