Rv0480c Family assigned · medium auto-curated

H37Rv Rv0480c · MTBC0 mtbc0_000505 · 280 aa · 572329–573171 (-) · RefSeq NP_214994.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)amidohydrolase
MTBC0 PGAP re-annotationcarbon-nitrogen hydrolase family protein
Revised (this work)Carbon-nitrogen hydrolase family protein. Pfam: CN_hydrolase (PF00795.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ01 SwissProt · reviewed · Evidence at protein level
UniProt nameHydrolase Rv0480c
EC (curated) EC 3.5.-.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionNitrilase cyanide hydratase and apolipoprotein N-acyltransferase
Orthologous groupCOG0388
KEGG orthology K11206
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.374 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CN_hydrolasePF00795.28 1.7e-412–258 Carbon-nitrogen hydrolase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0479c (membrane protein), high confidence from genomic context alone (score 882 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0479c membrane protein 882 882 ctx neighborhood:881
Rv0481c hyp hypothetical protein 744 745 ctx neighborhood:741
Rv0482 murB UDP-N-acetylenolpyruvoylglucosamine reductase 695 695 ctx neighborhood:691
Rv0483 lprQ lipoprotein LprQ 667 667 ctx neighborhood:661
Rv3068c pgmA phosphoglucomutase PgmA 618 599 database:544
Rv3339c icd1 isocitrate dehydrogenase 567 568 database:549
Rv2089c pepE dipeptidase PepE 559 559 database:497
Rv2535c pepQ cytoplasmic peptidase PepQ 558 558 database:497
Rv3315c cdd cytidine deaminase 576 556 database:522
Rv2365c hyp hypothetical protein 575 555 database:522
Rv2467 pepN aminopeptidase PepN 551 550 database:486
Rv2189c hyp hypothetical protein 551 549 database:486
Rv0331 dehydrogenase/reductase 466 438 coexpression:438
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 469 435 database:427
Rv0914c lipid carrier protein or keto acyl-CoA thiolase 453 432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: amidohydrolase
  • MTBC0 PGAP product: carbon-nitrogen hydrolase family protein
  • Pfam (hmmscan --cut_ga): CN_hydrolase PF00795.28 (E=2e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214994.2)
  • Domains: Pfam-A via hmmscan --cut_ga — CN_hydrolase (PF00795.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0388
  • Curated reference: UniProt P9WJ01 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor Rv0479c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000505|Rv0480c|
MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG