Rv0480c Family assigned · medium auto-curated
H37Rv Rv0480c · MTBC0 mtbc0_000505 ·
280 aa · 572329–573171 (-) ·
RefSeq NP_214994.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | amidohydrolase |
|---|---|
| MTBC0 PGAP re-annotation | carbon-nitrogen hydrolase family protein |
| Revised (this work) | Carbon-nitrogen hydrolase family protein. Pfam: CN_hydrolase (PF00795.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJ01
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Hydrolase Rv0480c |
| EC (curated) |
EC 3.5.-.-
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Nitrilase cyanide hydratase and apolipoprotein N-acyltransferase |
| Orthologous group | COG0388 |
| KEGG orthology |
K11206
|
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.374 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CN_hydrolase | PF00795.28 | 1.7e-41 | 2–258 | Carbon-nitrogen hydrolase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0479c (membrane protein), high confidence from genomic context alone (score 882 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0479c |
membrane protein | 882 | 882 ctx | neighborhood:881 |
Rv0481c hyp |
hypothetical protein | 744 | 745 ctx | neighborhood:741 |
Rv0482 murB |
UDP-N-acetylenolpyruvoylglucosamine reductase | 695 | 695 ctx | neighborhood:691 |
Rv0483 lprQ |
lipoprotein LprQ | 667 | 667 ctx | neighborhood:661 |
Rv3068c pgmA |
phosphoglucomutase PgmA | 618 | 599 | database:544 |
Rv3339c icd1 |
isocitrate dehydrogenase | 567 | 568 | database:549 |
Rv2089c pepE |
dipeptidase PepE | 559 | 559 | database:497 |
Rv2535c pepQ |
cytoplasmic peptidase PepQ | 558 | 558 | database:497 |
Rv3315c cdd |
cytidine deaminase | 576 | 556 | database:522 |
Rv2365c hyp |
hypothetical protein | 575 | 555 | database:522 |
Rv2467 pepN |
aminopeptidase PepN | 551 | 550 | database:486 |
Rv2189c hyp |
hypothetical protein | 551 | 549 | database:486 |
Rv0331 |
dehydrogenase/reductase | 466 | 438 | coexpression:438 |
Rv1248c kgd |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 469 | 435 | database:427 |
Rv0914c |
lipid carrier protein or keto acyl-CoA thiolase | 453 | 432 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: amidohydrolase
- MTBC0 PGAP product: carbon-nitrogen hydrolase family protein
- Pfam (hmmscan --cut_ga): CN_hydrolase PF00795.28 (E=2e-41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214994.2)
- Domains: Pfam-A via hmmscan --cut_ga — CN_hydrolase (PF00795.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0388 - Curated reference: UniProt P9WJ01 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
47 functional partner(s); context anchor
Rv0479c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000505|Rv0480c| MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG