cobK Resolved · high auto-curated

H37Rv Rv2070c · MTBC0 mtbc0_002204 · 244 aa · 2356104–2356838 (-) · RefSeq NP_216586.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)precorrin-6A reductase
MTBC0 PGAP re-annotationcobalt-precorrin-6A reductase
Revised (this work)Cobalt-precorrin-6A reductase. Pfam: CbiJ (PF02571.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP89 SwissProt · reviewed · Evidence at protein level
UniProt namePrecorrin-6A reductase
EC (curated) EC 1.3.1.54
Curated functionCatalyzes the reduction of the macrocycle of precorrin-6X into precorrin-6Y.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecobK
eggNOG descriptionreductase
Orthologous groupCOG2099
EC number EC 1.3.1.106, EC 1.3.1.54
KEGG orthology K05895
KEGG pathways map00860, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.767 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 17.66% of strains (25647) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CbiJPF02571.21 1.1e-733–238 Precorrin-6x reductase CbiJ/CobK

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cobIJ (bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 999 1000 ctx cooccurence:773 coexpression:999 textmining:554
Rv2072c cobL precorrin-6Y C(5,15)-methyltransferase 999 999 ctx neighborhood:881 cooccurence:774 coexpression:665 database:900 textmining:850
Rv2071c cobM precorrin-4 C(11)-methyltransferase 998 994 ctx neighborhood:881 cooccurence:740 coexpression:818 textmining:753
Rv2065 cobH precorrin-8X methylmutase 986 949 ctx cooccurence:774 coexpression:753 textmining:746
Rv0255c cobQ1 cobyric acid synthase 912 885 coexpression:799
Rv2073c oxidoreductase 805 805 ctx neighborhood:796
Rv2074 pyridoxamine 5'-phosphate oxidase 764 764 ctx neighborhood:731
Rv2064 cobG precorrin-3B synthase 910 759 ctx cooccurence:744 textmining:644
Rv2848c cobB cobyrinic acid A,C-diamide synthase 898 758 ctx cooccurence:664 textmining:598
Rv2062c cobN cobalamin biosynthesis protein CobN 960 749 ctx cooccurence:704 textmining:851
Rv2208 cobS adenosylcobinamide-GDP ribazoletransferase 789 725 coexpression:654
Rv2236c cobD cobalamin biosynthesis transmembrane protein CobD 743 664 ctx cooccurence:526
Rv2850c magnesium chelatase 484 484
Rv2423 hyp hypothetical protein 525 462 coexpression:431
Rv1487 hyp hypothetical protein 441 441 coexpression:423

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: precorrin-6A reductase
  • MTBC0 PGAP product: cobalt-precorrin-6A reductase
  • Pfam (hmmscan --cut_ga): CbiJ PF02571.21 (E=1e-73)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216586.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CbiJ (PF02571.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2099
  • Curated reference: UniProt P9WP89 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor cobIJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002204|Rv2070c|cobK
MTRVLLLGGTAEGRALAKELHPHVEIVSSLAGRVPNPALPIGPVRIGGFGGVEGLRGWLREERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPPWDPGTAIIAVSDIEAADVVAEQGYSRVFLTTGRSGIAAFANSDAWFLIRVVTAPDGTALPRRHKLVLSRGPYGYHDEFALLREQRIDALVTKNSGGKMTRAKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAGLPSR