cobK Resolved · high auto-curated
H37Rv Rv2070c · MTBC0 mtbc0_002204 ·
244 aa ·
2356104–2356838 MTBC0
(-) ·
RefSeq NP_216586.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | precorrin-6A reductase |
|---|---|
| MTBC0 PGAP re-annotation | cobalt-precorrin-6A reductase |
| Revised (this work) | Cobalt-precorrin-6A reductase. Pfam: CbiJ (PF02571.21). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its atlas annotation was built from sequence/structure evidence; UniProt nevertheless carries a reviewed entry with a named function for this protein, and experimental evidence that the protein exists (see below), so the absence of a locus-tag mention should not be read as the absence of any study.
Scope of the sweep: What was actually swept: the H37Rv locus tag and the ortholog locus tags (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), plus the gene name where one exists. NOT swept: protein and enzyme names, including family shorthands such as Ldt(Mt4) or VapC28, and their orthographic variants. An absent locus-tag mention is therefore evidence about the TAG, and only indirect evidence about the protein (P18.14).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 2 % of gene
| Neighbour | sigC (Rv2069, + strand) |
|---|---|
| Overlap | 11 bp, 2 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.12 (95% CI -0.67 to 3.88). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in cobalamin biosynthesis. |
|---|---|
| Mycobrowser EC |
1.3.1.54
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2096c
· 98.7% identity |
|---|---|
| M. marinum |
MMAR_3052
· 76.2% identity |
| M. smegmatis |
MSMEG_3875
· 69.8% identity |
| M. abscessus |
MAB_2197
· 59.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WP89
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Precorrin-6A reductase |
| EC (curated) |
EC 1.3.1.54
|
| Curated function | Catalyzes the reduction of the macrocycle of precorrin-6X into precorrin-6Y. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | cobK |
| eggNOG description | reductase |
| Orthologous group | COG2099 |
| EC number |
EC 1.3.1.106, EC 1.3.1.54
|
| KEGG orthology |
K05895
|
| KEGG pathways |
map00860, map01100
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.767 · quasi-invariant (6 sites), pN/pS sous-puissant |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 3 frameshift |
| Disruption | 3 distinct premature-stop/frameshift site(s); most common in 17.66% of strains (25647) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
undefined (dS = 0) (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 50/53 (94%) · mean identity 72.4%
· 3/4 closest MTBAP relatives conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 50.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) |
16 in the ORF —
0 in the essential state,
0 growth-defect,
16 non-essential,
0 growth-advantage.
Saturation 0.812,
mean read count 45.3076923077.
A region of the protein devoid of TA sites is invisible to this assay: nothing can be
inferred about it, in either direction.
15 of these 16 sites are exclusively this ORF's; Measured, not hypothetical: 1 of this ORF's 16 TA sites lies inside Rv2069 (1 site), leaving 15 sites that are exclusively its own. A transposon insertion cannot be assigned to one reading frame rather than the other, so the essentiality call rests on those 15 exclusive sites. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 7.08 ppm · rank 2815/3519 (20.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 244 aa |
|---|---|
| Molecular weight | 25.7 kDa |
| Theoretical pI | 9.24 |
| GRAVY | 0.264 (hydrophobic) |
| Aliphatic index | 107.2 |
| Aromaticity | 0.057 |
| Instability index | 33.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CbiJ | PF02571.21 | 1.1e-73 | 3–238 | Precorrin-6x reductase CbiJ/CobK |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4x7g-assembly1_A |
1.00 | 0.88 | 1.6e-22 sig | 4x7g-assembly1_A CobK precorrin-6A reductase |
5c4n-assembly1_D |
1.00 | 0.87 | 5.8e-22 sig | 5c4n-assembly1_D CobK precorrin-6A reductase |
5c4r-assembly1_A |
1.00 | 0.84 | 2.7e-21 sig | 5c4r-assembly1_A CobK precorrin-6A reductase |
4yrb-assembly1_B |
1.00 | 0.62 | 3.6e-04 sig | 4yrb-assembly1_B mouse TDH mutant R180K with NAD+ bound |
4yrb-assembly1_A |
1.00 | 0.61 | 1.0e-03 sig | 4yrb-assembly1_A mouse TDH mutant R180K with NAD+ bound |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | sigC (+ strand, -11 bp gap) |
|---|---|
| Downstream (3' on genome) | cobM (- strand, -4 bp gap) |
| Predicted operon |
cobK · cobM · cobL
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: cobIJ (bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2066 cobIJ |
bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase | 999 | 1000 ctx | cooccurence:773 coexpression:999 textmining:554 |
Rv2072c cobL exp |
precorrin-6Y C(5,15)-methyltransferase | 999 | 999 ctx | neighborhood:881 cooccurence:774 coexpression:665 database:900 textmining:850 |
Rv2071c cobM |
precorrin-4 C(11)-methyltransferase | 998 | 994 ctx | neighborhood:881 cooccurence:740 coexpression:818 textmining:753 |
Rv2065 cobH |
precorrin-8X methylmutase | 986 | 949 ctx | cooccurence:774 coexpression:753 textmining:746 |
Rv0255c cobQ1 |
cobyric acid synthase | 912 | 885 | coexpression:799 |
Rv2073c |
oxidoreductase | 805 | 805 ctx | neighborhood:796 |
Rv2074 |
pyridoxamine 5'-phosphate oxidase | 764 | 764 ctx | neighborhood:731 |
Rv2064 cobG |
precorrin-3B synthase | 910 | 759 ctx | cooccurence:744 textmining:644 |
Rv2848c cobB |
cobyrinic acid A,C-diamide synthase | 898 | 758 ctx | cooccurence:664 textmining:598 |
Rv2062c cobN |
cobalamin biosynthesis protein CobN | 960 | 749 ctx | cooccurence:704 textmining:851 |
Rv2208 cobS |
adenosylcobinamide-GDP ribazoletransferase | 789 | 725 | coexpression:654 |
Rv2236c cobD |
cobalamin biosynthesis transmembrane protein CobD | 743 | 664 ctx | cooccurence:526 |
Rv2850c |
magnesium chelatase | 484 | 484 | |
Rv2423 hyp |
hypothetical protein | 525 | 462 | coexpression:431 |
Rv1487 hyp |
hypothetical protein | 441 | 441 | coexpression:423 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: precorrin-6A reductase
- MTBC0 PGAP product: cobalt-precorrin-6A reductase
- Pfam (hmmscan --cut_ga): CbiJ PF02571.21 (E=1e-73)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216586.1)
- Domains: Pfam-A via hmmscan --cut_ga — CbiJ (PF02571.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2099 - Curated reference: UniProt P9WP89 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
33 functional partner(s); context anchor
cobIJ - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002204|Rv2070c|cobK MTRVLLLGGTAEGRALAKELHPHVEIVSSLAGRVPNPALPIGPVRIGGFGGVEGLRGWLREERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPPWDPGTAIIAVSDIEAADVVAEQGYSRVFLTTGRSGIAAFANSDAWFLIRVVTAPDGTALPRRHKLVLSRGPYGYHDEFALLREQRIDALVTKNSGGKMTRAKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAGLPSR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cobK? Email the maintainer — the message is pre-filled with this gene's details.