cobK Resolved · high auto-curated

H37Rv Rv2070c · MTBC0 mtbc0_002204 · 244 aa · 2356104–2356838 MTBC0 (-) · RefSeq NP_216586.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)precorrin-6A reductase
MTBC0 PGAP re-annotationcobalt-precorrin-6A reductase
Revised (this work)Cobalt-precorrin-6A reductase. Pfam: CbiJ (PF02571.21).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its atlas annotation was built from sequence/structure evidence; UniProt nevertheless carries a reviewed entry with a named function for this protein, and experimental evidence that the protein exists (see below), so the absence of a locus-tag mention should not be read as the absence of any study.

Silent tag, studied protein. No publication mentions this LOCUS TAG, yet UniProt P9WP89 is a reviewed SwissProt entry named 'Precorrin-6A reductase', at protein-existence level 1 (the protein has been detected experimentally). So the tag is silent while the protein is named and known to exist: do not read 'unstudied' as 'uncharacterised' here. Note the limit of this cross-check: UniProt's protein-existence level says the PROTEIN was observed, not that its FUNCTION was experimentally established, and this atlas does not store the per-annotation evidence codes that would settle that. Read the UniProt entry itself before citing the function as experimentally demonstrated.

Scope of the sweep: What was actually swept: the H37Rv locus tag and the ortholog locus tags (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), plus the gene name where one exists. NOT swept: protein and enzyme names, including family shorthands such as Ldt(Mt4) or VapC28, and their orthographic variants. An absent locus-tag mention is therefore evidence about the TAG, and only indirect evidence about the protein (P18.14).

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) antiparallel · 2 % of gene

NeighboursigC (Rv2069, + strand)
Overlap11 bp, 2 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.12 (95% CI -0.67 to 3.88). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in cobalamin biosynthesis.
Mycobrowser EC 1.3.1.54 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2096c · 98.7% identity
M. marinum MMAR_3052 · 76.2% identity
M. smegmatis MSMEG_3875 · 69.8% identity
M. abscessus MAB_2197 · 59.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WP89 SwissProt · reviewed · Evidence at protein level
UniProt namePrecorrin-6A reductase
EC (curated) EC 1.3.1.54
Curated functionCatalyzes the reduction of the macrocycle of precorrin-6X into precorrin-6Y.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecobK
eggNOG descriptionreductase
Orthologous groupCOG2099
EC number EC 1.3.1.106, EC 1.3.1.54
KEGG orthology K05895
KEGG pathways map00860, map01100

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.767 · quasi-invariant (6 sites), pN/pS sous-puissant
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 17.66% of strains (25647) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) undefined (dS = 0) (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 72.4% · 3/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 50.5%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 0.812, mean read count 45.3076923077. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
15 of these 16 sites are exclusively this ORF's; Measured, not hypothetical: 1 of this ORF's 16 TA sites lies inside Rv2069 (1 site), leaving 15 sites that are exclusively its own. A transposon insertion cannot be assigned to one reading frame rather than the other, so the essentiality call rests on those 15 exclusive sites.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 8 of 16 independent MS datasets
Integrated abundance7.08 ppm · rank 2815/3519 (20.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length244 aa
Molecular weight25.7 kDa
Theoretical pI9.24
GRAVY0.264 (hydrophobic)
Aliphatic index107.2
Aromaticity0.057
Instability index33.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CbiJPF02571.21 1.1e-733–238 Precorrin-6x reductase CbiJ/CobK

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4

PDB hitprobTM-scoreE-valueDescription
4x7g-assembly1_A 1.00 0.88 1.6e-22 sig 4x7g-assembly1_A CobK precorrin-6A reductase
5c4n-assembly1_D 1.00 0.87 5.8e-22 sig 5c4n-assembly1_D CobK precorrin-6A reductase
5c4r-assembly1_A 1.00 0.84 2.7e-21 sig 5c4r-assembly1_A CobK precorrin-6A reductase
4yrb-assembly1_B 1.00 0.62 3.6e-04 sig 4yrb-assembly1_B mouse TDH mutant R180K with NAD+ bound
4yrb-assembly1_A 1.00 0.61 1.0e-03 sig 4yrb-assembly1_A mouse TDH mutant R180K with NAD+ bound

Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)sigC (+ strand, -11 bp gap)
Downstream (3' on genome)cobM (- strand, -4 bp gap)
Predicted operon cobK · cobM · cobL

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: cobIJ (bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 999 1000 ctx cooccurence:773 coexpression:999 textmining:554
Rv2072c cobL exp precorrin-6Y C(5,15)-methyltransferase 999 999 ctx neighborhood:881 cooccurence:774 coexpression:665 database:900 textmining:850
Rv2071c cobM precorrin-4 C(11)-methyltransferase 998 994 ctx neighborhood:881 cooccurence:740 coexpression:818 textmining:753
Rv2065 cobH precorrin-8X methylmutase 986 949 ctx cooccurence:774 coexpression:753 textmining:746
Rv0255c cobQ1 cobyric acid synthase 912 885 coexpression:799
Rv2073c oxidoreductase 805 805 ctx neighborhood:796
Rv2074 pyridoxamine 5'-phosphate oxidase 764 764 ctx neighborhood:731
Rv2064 cobG precorrin-3B synthase 910 759 ctx cooccurence:744 textmining:644
Rv2848c cobB cobyrinic acid A,C-diamide synthase 898 758 ctx cooccurence:664 textmining:598
Rv2062c cobN cobalamin biosynthesis protein CobN 960 749 ctx cooccurence:704 textmining:851
Rv2208 cobS adenosylcobinamide-GDP ribazoletransferase 789 725 coexpression:654
Rv2236c cobD cobalamin biosynthesis transmembrane protein CobD 743 664 ctx cooccurence:526
Rv2850c magnesium chelatase 484 484
Rv2423 hyp hypothetical protein 525 462 coexpression:431
Rv1487 hyp hypothetical protein 441 441 coexpression:423

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: precorrin-6A reductase
  • MTBC0 PGAP product: cobalt-precorrin-6A reductase
  • Pfam (hmmscan --cut_ga): CbiJ PF02571.21 (E=1e-73)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216586.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CbiJ (PF02571.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2099
  • Curated reference: UniProt P9WP89 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor cobIJ
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002204|Rv2070c|cobK
MTRVLLLGGTAEGRALAKELHPHVEIVSSLAGRVPNPALPIGPVRIGGFGGVEGLRGWLREERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPPWDPGTAIIAVSDIEAADVVAEQGYSRVFLTTGRSGIAAFANSDAWFLIRVVTAPDGTALPRRHKLVLSRGPYGYHDEFALLREQRIDALVTKNSGGKMTRAKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAGLPSR