Rv2073c Family assigned · medium auto-curated
H37Rv Rv2073c · MTBC0 mtbc0_002207 ·
249 aa · 2358827–2359576 (-) ·
RefSeq NP_216589.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | SDR family NAD(P)-dependent oxidoreductase |
| Revised (this work) | SDR family NAD(P)-dependent oxidoreductase. Pfam: adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGR3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized oxidoreductase Rv2073c |
| EC (curated) |
EC 1.-.-.-
|
UniProt still lists this protein as Uncharacterized oxidoreductase Rv2073c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Short-chain dehydrogenase reductase sdr |
| Orthologous group | COG0300 |
| EC number |
EC 1.1.1.333
|
| KEGG orthology |
K16652
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.786 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
adh_short | PF00106.32 | 4.1e-25 | 9–195 | short chain dehydrogenase |
KR | PF08659.17 | 1.8e-09 | 9–171 | KR domain |
adh_short_C2 | PF13561.13 | 9.9e-16 | 17–197 | Enoyl-(Acyl carrier protein) reductase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cobL (precorrin-6Y C(5,15)-methyltransferase), high confidence from genomic context alone (score 943 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2072c cobL |
precorrin-6Y C(5,15)-methyltransferase | 943 | 943 ctx | neighborhood:796 coexpression:732 |
Rv2070c cobK |
precorrin-6A reductase | 805 | 805 ctx | neighborhood:796 |
Rv2071c cobM |
precorrin-4 C(11)-methyltransferase | 805 | 805 ctx | neighborhood:796 |
Rv2074 |
pyridoxamine 5'-phosphate oxidase | 803 | 804 ctx | neighborhood:790 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 794 | 786 ctx | cooccurence:772 |
Rv3790 dprE1 |
decaprenylphosphoryl-beta-D-ribose oxidase | 787 | 786 ctx | cooccurence:774 |
Rv3789 |
GtrA family protein | 735 | 736 ctx | cooccurence:726 |
Rv3793 embC |
arabinosyltransferase C | 414 | 391 | |
Rv3795 embB |
arabinosyltransferase B | 406 | 382 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: oxidoreductase
- MTBC0 PGAP product: SDR family NAD(P)-dependent oxidoreductase
- Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=4e-25), KR PF08659.17 (E=2e-09), adh_short_C2 PF13561.13 (E=1e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216589.1)
- Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0300 - Curated reference: UniProt P9WGR3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
9 functional partner(s); context anchor
cobL - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002207|Rv2073c| MDDTGAAPVVIFGGRSQIGGELARRLAAGATMVLAARNADQLADQAAALRAAGAIAVHTREFDADDLAAHGPLVASLVAEHGPIGTAVLAFGILGDQARAETDAAHAVAIVHTDYVAQVSLLTHLAAAMRTAGRGSLVVFSSVAGIRVRRANYVYGSAKAGLDGFASGLADALHGTGVRLLIARPGFVIGRMTEGMTPAPLSVTPERVAAATARALVNGKRVVWIPWALRPMFVALRLLPRFVWRRMPR