tam Resolved · high auto-curated
H37Rv Rv0294 · MTBC0 mtbc0_000313 ·
261 aa ·
361465–362250 MTBC0
(+) ·
RefSeq NP_214808.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | trans-aconitate methyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | trans-aconitate 2-methyltransferase |
| Revised (this work) | Trans-aconitate 2-methyltransferase. Pfam: Methyltransf_23 (PF13489.13), FtsJ (PF01728.26), MTS (PF05175.21), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 34 publications
34 TB publications mention this gene. 34 publication(s) discuss this gene (41 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (2), M. abscessus (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Alterations in the Immune Response in Individuals with Latent Tuberculosis Infection. doi:10.3390/pathogens15010014 | 2025 |
| Tamoxifen inhibits histidine kinases of M. tuberculosis two-component signaling systems. doi:10.1128/spectrum.01880-25 | 2026 |
| Unlocking the potential of Calculus bovis: A breakthrough in liver cancer treatment via Wnt/β-catenin pathway modulation. doi:10.3748/wjg.v31.i4.99397 | 2025 |
| Calculus bovis hijacks the tumor microenvironment in liver cancer cells in a multifaceted approach: A falling row of dominoes. doi:10.3748/wjg.v30.i48.5221 | 2024 |
| MicroRNA-206 as a promising epigenetic approach to modulate tumor-associated macrophages in hepatocellular carcinoma. doi:10.3748/wjg.v30.i41.4503 | 2024 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 2 % of gene
| Neighbour | stf0 (Rv0295c, - strand) |
|---|---|
| Overlap | 12 bp, 2 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.06 (95% CI -4.18 to 5.36). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Possibly catalyzes the S-adenosylmethionine monomethyl esterification of trans-aconitate at high affinity and of cis-aconitate, isocitrate, and citrate at lower velocities and affinities. |
|---|---|
| Mycobrowser EC |
2.1.1.144
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0302
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_0553
· 83.8% identity |
| M. smegmatis |
MSMEG_0629
· 61.7% identity |
| M. orygis |
RJtmp_000312
· 100.0% identity |
| M. abscessus |
MAB_2845
· 42.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGA3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable trans-aconitate 2-methyltransferase |
| EC (curated) |
EC 2.1.1.144
|
| Curated function | Catalyzes the S-adenosylmethionine monomethyl esterification of trans-aconitate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | tam |
| eggNOG description | Catalyzes the S-adenosylmethionine monomethyl esterification of trans-aconitate |
| Orthologous group | COG4106 |
| EC number |
EC 2.1.1.144
|
| KEGG orthology |
K00598
|
| Gene Ontology (23) |
GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0008150, GO:0008152, GO:0008168, GO:0008757, GO:0016740, GO:0016741 +11 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.273 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 80.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 44.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 0.867, mean read count 95.9230769231. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 11.5 ppm · rank 2624/3519 (25.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 261 aa |
|---|---|
| Molecular weight | 29.3 kDa |
| Theoretical pI | 5.83 |
| GRAVY | -0.23 (hydrophilic) |
| Aliphatic index | 87.4 |
| Aromaticity | 0.096 |
| Instability index | 43.1 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Methyltransf_23 | PF13489.13 | 5.9e-13 | 13–146 | Methyltransferase domain |
FtsJ | PF01728.26 | 3.0e-05 | 20–95 | FtsJ-like methyltransferase |
MTS | PF05175.21 | 3.6e-05 | 22–100 | Methyltransferase small domain |
Methyltransf_31 | PF13847.13 | 4.3e-07 | 30–127 | Methyltransferase domain |
Methyltransf_25 | PF13649.13 | 1.7e-13 | 33–119 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 4.8e-12 | 34–123 | Methyltransferase domain |
Methyltransf_12 | PF08242.19 | 7.2e-10 | 34–121 | Methyltransferase domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2p35-assembly1_B |
1.00 | 0.89 | 5.3e-24 sig | 2p35-assembly1_B Crystal structure of trans-aconitate methyltransferase from Agrobacterium tumefaciens |
2p35-assembly1_A |
1.00 | 0.86 | 9.6e-24 sig | 2p35-assembly1_A Crystal structure of trans-aconitate methyltransferase from Agrobacterium tumefaciens |
3ccf-assembly1_A |
1.00 | 0.79 | 4.5e-16 sig | 3ccf-assembly1_A Crystal structure of putative methyltransferase (YP_321342.1) from Anabaena variabilis ATCC 29413 at 1.90 A resolution |
7ec0-assembly1_A |
1.00 | 0.75 | 5.0e-13 sig | 7ec0-assembly1_A Crystal structure of juvenile hormone acid methyltransferase JHAMT in complex with S-Adenosyl homocysteine and methyl farnesoate |
7veo-assembly1_B |
1.00 | 0.75 | 1.4e-12 sig | 7veo-assembly1_B Crystal structure of juvenile hormone acid methyltransferase silkworm JHAMT isoform3 complex with S-Adenosyl-L-homocysteine |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv0293c (- strand, 106 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0295c (- strand, -12 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
mmpR5 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0293c hyp |
hypothetical protein | 778 | 778 ctx | neighborhood:777 |
Rv2628 hyp |
hypothetical protein | 627 | 47 | textmining:625 |
Rv0987 |
adhesion component ABC transporter permease | 652 | 46 | textmining:651 |
Rv3019c esxR |
ESAT-6 like protein EsxR | 541 | 44 | textmining:540 |
Rv1769 hyp |
hypothetical protein | 870 | 41 | textmining:870 |
Rv0988 hyp |
hypothetical protein | 803 | 41 | textmining:803 |
Rv0289 espG3 |
ESX-3 secretion-associated protein EspG3 | 548 | 41 | textmining:548 |
Rv0291 mycP3 |
membrane-anchored mycosin MycP | 511 | 41 | textmining:511 |
Rv3879c espK |
ESX-1 secretion-associated protein EspK | 412 | 41 | textmining:412 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: trans-aconitate methyltransferase
- MTBC0 PGAP product: trans-aconitate 2-methyltransferase
- Pfam (hmmscan --cut_ga): Methyltransf_23 PF13489.13 (E=6e-13), FtsJ PF01728.26 (E=3e-05), MTS PF05175.21 (E=4e-05), Methyltransf_31 PF13847.13 (E=4e-07), Methyltransf_25 PF13649.13 (E=2e-13), Methyltransf_11 PF08241.19 (E=5e-12), Methyltransf_12 PF08242.19 (E=7e-10)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214808.1)
- Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_23 (PF13489.13), FtsJ (PF01728.26), MTS (PF05175.21), Methyltransf_31 (PF13847.13), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4106 - Curated reference: UniProt P9WGA3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000313|Rv0294|tam MWDPDVYLAFSGHRNRPFYELVSRVGLERARRVVDLGCGPGHLTRYLARRWPGAVIEALDSSPEMVAAAAERGIDATTGDLRDWKPKPDTDVVVSNAALHWVPEHSDLLVRWVDELAPGSWIAVQIPGNFETPSHAAVRALARREPYAKLMRDIPFRVGAVVQSPAYYAELLMDTGCKVDVWETTYLHQLTGEHPVLDWITGSALVPVRERLSDESWQQFRQELIPLLNDAYPPRADGSTIFPFRRLFMVAEVGGARRSGG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for tam? Email the maintainer — the message is pre-filled with this gene's details.