Rv2628 Still unknown · low auto-curated

H37Rv Rv2628 · MTBC0 - · 120 aa · 2955058–2955420 (+) · RefSeq NP_217144.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7xzi-assembly1_F Cryo-EM structure of TOC-TIC supercomplex from Chlamy (prob 0.10, TM 0.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WL65 SwissProt · reviewed · Evidence at protein level
UniProt namePutative uncharacterized protein Rv2628

UniProt still lists this protein as Putative uncharacterized protein Rv2628; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B0W9
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.507 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 60.5 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7xzi-assembly1_F 0.10 0.32 9.2e-01 7xzi-assembly1_F Cryo-EM structure of TOC-TIC supercomplex from Chlamydomonas reinhardtii
8p23-assembly1_B 0.10 0.53 2.1e+00 8p23-assembly1_B Cryo-EM structure of the anaerobic ribonucleotide reductase from Prevotella copri in its dimeric, ATP/CTP-bound state
1q1o-assembly1_A 0.06 0.44 4.4e+00 1q1o-assembly1_A Solution Structure of the PB1 Domain of Cdc24p (Long Form)
7bqn-assembly1_A 0.02 0.36 7.9e+00 7bqn-assembly1_A Solution NMR structure of fold-C Rei; de novo designed protein with an asymmetric all-alpha topology
4ic7-assembly2_E 0.02 0.36 7.9e+00 4ic7-assembly2_E Crystal structure of the ERK5 kinase domain in complex with an MKK5 binding fragment
2o2v-assembly1_A 0.01 0.20 3.4e+00 2o2v-assembly1_A Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
4ic7-assembly1_B 0.01 0.34 9.0e+00 4ic7-assembly1_B Crystal structure of the ERK5 kinase domain in complex with an MKK5 binding fragment
9g6k-assembly1_LD 0.01 0.18 8.4e+00 9g6k-assembly1_LD LSU structure derived from the LSU sample of the mitoribosome from T. gondii.

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2627c hyp hypothetical protein 829 830 coexpression:731
Rv2625c rip3 zinc metalloprotease Rip3 797 797 coexpression:797
Rv2624c universal stress protein 830 796 coexpression:796
Rv1997 ctpF cation transporter ATPase F 835 767 coexpression:767
Rv2623 TB31.7 universal stress protein 817 761 coexpression:761
Rv2626c hrp1 hypoxic response protein 904 735 coexpression:735 textmining:654
Rv1736c narX nitrate reductase-like protein NarX 747 731 coexpression:731
Rv3132c devS two component sensor histidine kinase DevS 703 703 coexpression:703
Rv3128c Rv3128c, (MTCY164.38c), len: 337 aa. Conserved hypothetical protein, similar to other conserved hypothetical proteins. This ORF corresponds 687 687 coexpression:687
Rv2629 hyp hypothetical protein 574 574 ctx neighborhood:414
Rv2630 hyp hypothetical protein 534 534
Rv2029c pfkB 6-phosphofructokinase PfkB 514 514 coexpression:514
Rv2631 rtcB RNA-splicing ligase RtcB 431 431
Rv1733c transmembrane protein 878 406 coexpression:404 textmining:803
Rv3134c universal stress protein 493 392

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 7xzi-assembly1_F Cryo-EM structure of TOC-TIC supercomplex from Chlamydomonas re (prob 0.10, E=9e-01, TM=0.32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217144.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B0W9
  • Curated reference: UniProt P9WL65 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 60.5, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2628|
MSTQRPRHSGIRAVGPYAWAGRCGRIGRWGVHQEAMMNLAIWHPRKVQSATIYQVTDRSHDGRTARVPGDEITSTVSGWLSELGTQSPLADELARAVRIGDWPAAYAIGEHLSVEIAVAV