Rv0370c Family assigned · medium auto-curated

H37Rv Rv0370c · MTBC0 mtbc0_000390 · 298 aa · 450509–451405 (-) · RefSeq NP_214884.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationMoxR family ATPase
Revised (this work)MoxR family ATPase. Pfam: AAA_5 (PF07728.21), AAA (PF00004.36).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53705 TrEMBL · unreviewed · Predicted
UniProt namePossible oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAAA domain (dynein-related subfamily)
Orthologous groupCOG0714

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.536 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_5PF07728.21 1.2e-1037–192 AAA domain (dynein-related subfamily)
AAAPF00004.36 5.4e-0838–192 ATPase family associated with various cellular activities (AAA)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0373c (carbon monoxyde dehydrogenase large subunit), high confidence from genomic context alone (score 956 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0373c carbon monoxyde dehydrogenase large subunit 957 956 ctx neighborhood:861 cooccurence:690
Rv0368c hyp hypothetical protein 947 946 ctx neighborhood:773 cooccurence:770
Rv0375c carbon monoxyde dehydrogenase medium subunit 939 937 ctx neighborhood:850 cooccurence:588
Rv0372c hyp hypothetical protein 928 928 ctx neighborhood:882 cooccurence:400
Rv0371c hyp hypothetical protein 900 900 ctx neighborhood:882
Rv0369c membrane oxidoreductase 972 895 ctx neighborhood:773 cooccurence:551 textmining:751
Rv0374c carbon monoxyde dehydrogenase small subunit 896 891 ctx neighborhood:861
Rv0376c hyp hypothetical protein 820 820 ctx neighborhood:768
Rv2425c hyp hypothetical protein 762 759 ctx cooccurence:728
Rv0377 HTH-type transcriptional regulator 722 711 ctx neighborhood:709
Rv0365c hyp hypothetical protein 684 685 ctx neighborhood:683
Rv0367c hyp hypothetical protein 429 429 ctx neighborhood:427
Rv2332 mez malate oxidoreductase 427 427 coexpression:417
Rv2531c amino acid decarboxylase 432 408 experimental:405
Rv3352c oxidoreductase 807 64 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: MoxR family ATPase
  • Pfam (hmmscan --cut_ga): AAA_5 PF07728.21 (E=1e-10), AAA PF00004.36 (E=5e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214884.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_5 (PF07728.21), AAA (PF00004.36)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0714
  • Curated reference: UniProt O53705 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor Rv0373c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000390|Rv0370c|
MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPGVGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDISEADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPELGTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPEPDRAAAIVRRTVPGATAPLIENATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDDRTQIRDAYQAFTECSHA