Rv0370c Family assigned · medium auto-curated

H37Rv Rv0370c · MTBC0 mtbc0_000390 · 298 aa · 450509–451405 MTBC0 (-) · RefSeq NP_214884.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationMoxR family ATPase
Revised (this work)MoxR family ATPase. Pfam: AAA_5 (PF07728.21), AAA (PF00004.36).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
Structural modeling and biochemical characterization of MSMEG_0748, a MoxR ATPase from Mycobacterium smegmatis. doi:10.1016/j.csbj.2025.11.010 2025

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourRv0371c (Rv0371c, - strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.18 (95% CI -0.07 to 3.29). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; probably involved in cellular metabolism.
Mycobrowser EC 1.-.-.-

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0377c · 99.3% identity
M. marinum MMAR_0660 · 87.0% identity
M. smegmatis MSMEG_0748 · 78.7% identity
M. orygis RJtmp_000387 · 99.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53705 TrEMBL · unreviewed · Predicted
UniProt namePossible oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAAA domain (dynein-related subfamily)
Orthologous groupCOG0714

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.536 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.358 (low power) · 5 consensus substitution(s)
low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 69.2% · 3/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 5/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 52.9%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 21 in the ORF — 0 in the essential state, 0 growth-defect, 21 non-essential, 0 growth-advantage. Saturation 0.857, mean read count 32.2222222222. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 2 of 16 independent MS datasets
Integrated abundance0.33 ppm · rank 3395/3519 (3.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length298 aa
Molecular weight32.6 kDa
Theoretical pI4.62
GRAVY-0.029 (hydrophilic)
Aliphatic index102.9
Aromaticity0.067
Instability index39.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_5PF07728.21 1.2e-1037–192 AAA domain (dynein-related subfamily)
AAAPF00004.36 5.4e-0838–192 ATPase family associated with various cellular activities (AAA)

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.8

PDB hitprobTM-scoreE-valueDescription
5c3c-assembly1_A 1.00 0.78 2.3e-10 sig 5c3c-assembly1_A Structural characterization of a newly identified component of alpha-carboxysomes: The AAA+ domain Protein cso-CbbQ
9cc3-assembly1_B 1.00 0.60 8.6e-08 sig 9cc3-assembly1_B Human Mitochondrial LONP1 Stall State + casein
7ksm-assembly1_C 1.00 0.58 7.3e-08 sig 7ksm-assembly1_C Human mitochondrial LONP1 with endogenous substrate
7krz-assembly1_E 1.00 0.55 3.2e-08 sig 7krz-assembly1_E Human mitochondrial LONP1 in complex with Bortezomib
7krz-assembly1_A 1.00 0.54 2.9e-08 sig 7krz-assembly1_A Human mitochondrial LONP1 in complex with Bortezomib

Foldseek search of the AlphaFold DB model (mean pLDDT 92.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 6

Upstream (5' on genome)Rv0369c (- strand, 100 bp gap)
Downstream (3' on genome)Rv0371c (- strand, -4 bp gap)
Predicted operon Rv0370c · Rv0371c · Rv0372c · Rv0373c · Rv0374c · Rv0375c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0373c (carbon monoxyde dehydrogenase large subunit), high confidence from genomic context alone (score 956 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0373c carbon monoxyde dehydrogenase large subunit 957 956 ctx neighborhood:861 cooccurence:690
Rv0368c hyp hypothetical protein 947 946 ctx neighborhood:773 cooccurence:770
Rv0375c carbon monoxyde dehydrogenase medium subunit 939 937 ctx neighborhood:850 cooccurence:588
Rv0372c hyp hypothetical protein 928 928 ctx neighborhood:882 cooccurence:400
Rv0371c hyp hypothetical protein 900 900 ctx neighborhood:882
Rv0369c membrane oxidoreductase 972 895 ctx neighborhood:773 cooccurence:551 textmining:751
Rv0374c carbon monoxyde dehydrogenase small subunit 896 891 ctx neighborhood:861
Rv0376c hyp hypothetical protein 820 820 ctx neighborhood:768
Rv2425c hyp hypothetical protein 762 759 ctx cooccurence:728
Rv0377 HTH-type transcriptional regulator 722 711 ctx neighborhood:709
Rv0365c hyp hypothetical protein 684 685 ctx neighborhood:683
Rv0367c hyp hypothetical protein 429 429 ctx neighborhood:427
Rv2332 mez malate oxidoreductase 427 427 coexpression:417
Rv2531c exp amino acid decarboxylase 432 408 experimental:405
Rv3352c oxidoreductase 807 64 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: MoxR family ATPase
  • Pfam (hmmscan --cut_ga): AAA_5 PF07728.21 (E=1e-10), AAA PF00004.36 (E=5e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214884.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_5 (PF07728.21), AAA (PF00004.36)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0714
  • Curated reference: UniProt O53705 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor Rv0373c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000390|Rv0370c|
MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPGVGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDISEADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPELGTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPEPDRAAAIVRRTVPGATAPLIENATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDDRTQIRDAYQAFTECSHA