Rv0370c Family assigned · medium auto-curated
H37Rv Rv0370c · MTBC0 mtbc0_000390 ·
298 aa · 450509–451405 (-) ·
RefSeq NP_214884.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | MoxR family ATPase |
| Revised (this work) | MoxR family ATPase. Pfam: AAA_5 (PF07728.21), AAA (PF00004.36). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53705
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible oxidoreductase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | AAA domain (dynein-related subfamily) |
| Orthologous group | COG0714 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.536 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AAA_5 | PF07728.21 | 1.2e-10 | 37–192 | AAA domain (dynein-related subfamily) |
AAA | PF00004.36 | 5.4e-08 | 38–192 | ATPase family associated with various cellular activities (AAA) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0373c (carbon monoxyde dehydrogenase large subunit), high confidence from genomic context alone (score 956 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0373c |
carbon monoxyde dehydrogenase large subunit | 957 | 956 ctx | neighborhood:861 cooccurence:690 |
Rv0368c hyp |
hypothetical protein | 947 | 946 ctx | neighborhood:773 cooccurence:770 |
Rv0375c |
carbon monoxyde dehydrogenase medium subunit | 939 | 937 ctx | neighborhood:850 cooccurence:588 |
Rv0372c hyp |
hypothetical protein | 928 | 928 ctx | neighborhood:882 cooccurence:400 |
Rv0371c hyp |
hypothetical protein | 900 | 900 ctx | neighborhood:882 |
Rv0369c |
membrane oxidoreductase | 972 | 895 ctx | neighborhood:773 cooccurence:551 textmining:751 |
Rv0374c |
carbon monoxyde dehydrogenase small subunit | 896 | 891 ctx | neighborhood:861 |
Rv0376c hyp |
hypothetical protein | 820 | 820 ctx | neighborhood:768 |
Rv2425c hyp |
hypothetical protein | 762 | 759 ctx | cooccurence:728 |
Rv0377 |
HTH-type transcriptional regulator | 722 | 711 ctx | neighborhood:709 |
Rv0365c hyp |
hypothetical protein | 684 | 685 ctx | neighborhood:683 |
Rv0367c hyp |
hypothetical protein | 429 | 429 ctx | neighborhood:427 |
Rv2332 mez |
malate oxidoreductase | 427 | 427 | coexpression:417 |
Rv2531c |
amino acid decarboxylase | 432 | 408 | experimental:405 |
Rv3352c |
oxidoreductase | 807 | 64 | textmining:803 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: oxidoreductase
- MTBC0 PGAP product: MoxR family ATPase
- Pfam (hmmscan --cut_ga): AAA_5 PF07728.21 (E=1e-10), AAA PF00004.36 (E=5e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214884.1)
- Domains: Pfam-A via hmmscan --cut_ga — AAA_5 (PF07728.21), AAA (PF00004.36)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0714 - Curated reference: UniProt O53705 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
Rv0373c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000390|Rv0370c| MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPGVGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDISEADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPELGTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPEPDRAAAIVRRTVPGATAPLIENATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDDRTQIRDAYQAFTECSHA