Rv1711 Resolved · high auto-curated

H37Rv Rv1711 · MTBC0 mtbc0_001821 · 254 aa · 1950853–1951617 (+) · RefSeq NP_216227.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)RNA pseudouridine synthase
MTBC0 PGAP re-annotationpseudouridine synthase
Revised (this work)Pseudouridine synthase. Pfam: S4 (PF01479.31), PseudoU_synth_2 (PF00849.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHQ1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized RNA pseudouridine synthase Rv1711
EC (curated) EC 5.4.99.-

UniProt still lists this protein as Uncharacterized RNA pseudouridine synthase Rv1711; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerluB
eggNOG descriptionBelongs to the pseudouridine synthase RsuA family
Orthologous groupCOG1187
EC number EC 5.4.99.19, EC 5.4.99.22
KEGG orthology K06178, K06183
Gene Ontology (45) GO:0000154, GO:0000455, GO:0001522, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006364 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.488 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
S4PF01479.31 3.3e-1315–57 S4 domain
PseudoU_synth_2PF00849.28 2.1e-2376–211 RNA pseudouridylate synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cmk (cytidylate kinase), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1712 cmk cytidylate kinase 997 995 ctx neighborhood:882 fusion:592 coexpression:886 textmining:489
Rv1713 engA GTPase Der 995 993 ctx neighborhood:881 cooccurence:704 coexpression:810
Rv1710 scpB segregation and condensation protein ScpB 988 977 ctx neighborhood:881 coexpression:814 textmining:509
Rv1709 scpA segregation and condensation protein ScpA 964 932 ctx neighborhood:881 coexpression:451 textmining:505
Rv1708 initiation inhibitor protein 886 887 ctx neighborhood:881
Rv0427c xthA exodeoxyribonuclease III protein XthA 814 815 coexpression:805
Rv1707 transmembrane protein 743 744 ctx neighborhood:744
Rv1714 oxidoreductase 601 601 ctx neighborhood:520
Rv1703c methyltransferase 562 563 ctx neighborhood:544
Rv1715 fadB3 3-hydroxybutyryl-CoA dehydrogenase FadB 540 540 ctx neighborhood:519
Rv2364c era GTPase Era 546 517 ctx cooccurence:431
Rv1716 hyp hypothetical protein 511 511 ctx neighborhood:489
Rv1717 hyp hypothetical protein 488 488 ctx neighborhood:476
Rv1420 uvrC excinuclease ABC subunit UvrC 481 481 ctx cooccurence:442
Rv2440c obg GTPase Obg 518 477 ctx cooccurence:410

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: RNA pseudouridine synthase
  • MTBC0 PGAP product: pseudouridine synthase
  • Pfam (hmmscan --cut_ga): S4 PF01479.31 (E=3e-13), PseudoU_synth_2 PF00849.28 (E=2e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216227.1)
  • Domains: Pfam-A via hmmscan --cut_ga — S4 (PF01479.31), PseudoU_synth_2 (PF00849.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1187
  • Curated reference: UniProt P9WHQ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor cmk
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001821|Rv1711|
MMAEPEESREPRGIRLQKVLSQAGIASRRAAEKMIVDGRVEVDGHVVTELGTRVDPQVAVVRVDGARVVLDDSLVYLALNKPRGMHSTMSDDRGRPCIGDLIERKVRGTKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYLATVTGSVPRGLGRTLRAGIELDDGPAFVDDFAVVDAIPGKTLVRVTLHEGRNRIVRRLLAAAGFPVEALVRTDIGAVSLGKQRPGSVRALRSNEIGQLYQAVGL