Rv1711 Resolved · high auto-curated
H37Rv Rv1711 · MTBC0 mtbc0_001821 ·
254 aa ·
1950853–1951617 MTBC0
(+) ·
RefSeq NP_216227.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | RNA pseudouridine synthase |
|---|---|
| MTBC0 PGAP re-annotation | pseudouridine synthase |
| Revised (this work) | Pseudouridine synthase. Pfam: S4 (PF01479.31), PseudoU_synth_2 (PF00849.28). |
| Functional category (TubercuList) | conserved hypotheticals |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | scpB (Rv1710, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Unc_5.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -2.50 (95% CI -3.17 to -1.85). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|---|
| Mycobrowser EC |
5.4.99.-
· agrees with the atlas
|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number, COG category, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1738
· 99.6% identity |
|---|---|
| M. leprae |
ML1370
· 80.5% identity |
| M. marinum |
MMAR_2526
· 85.0% identity |
| M. smegmatis |
MSMEG_3740
· 80.0% identity |
| M. orygis |
RJtmp_001790
· 99.6% identity |
| M. abscessus |
MAB_2370
· 70.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHQ1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized RNA pseudouridine synthase Rv1711 |
| EC (curated) |
EC 5.4.99.-
|
UniProt still lists this protein as Uncharacterized RNA pseudouridine synthase Rv1711; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rluB |
| eggNOG description | Belongs to the pseudouridine synthase RsuA family |
| Orthologous group | COG1187 |
| EC number |
EC 5.4.99.19, EC 5.4.99.22
|
| KEGG orthology |
K06178, K06183
|
| Gene Ontology (45) |
GO:0000154, GO:0000455, GO:0001522, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006364 +33 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.488 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 58.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) GD — not strictly essential
| DeJesus 2017 call | GD · growth-defect |
|---|---|
| What the call means | growth-defect: insertions tolerated but fitness reduced; NOT essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 10 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.500, mean read count 3. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | `essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | H37RvMA::Rv1711-FLAG/DAS+pTetON-18 sspB (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.059 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Ethambutol (drug exposure) | +7.89 | 0.032 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 53.4 ppm · rank 1710/3519 (51.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 254 aa |
|---|---|
| Molecular weight | 27.6 kDa |
| Theoretical pI | 9.36 |
| GRAVY | -0.163 (hydrophilic) |
| Aliphatic index | 101.3 |
| Aromaticity | 0.028 |
| Instability index | 32.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
S4 | PF01479.31 | 3.3e-13 | 15–57 | S4 domain |
PseudoU_synth_2 | PF00849.28 | 2.1e-23 | 76–211 | RNA pseudouridylate synthase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4lgt-assembly2_D |
1.00 | 0.68 | 5.8e-25 sig | 4lgt-assembly2_D Crystal structure of the catalytic domain of RluB in complex with a 21-nucleotide RNA substrate |
4lgt-assembly1_A |
1.00 | 0.67 | 5.2e-25 sig | 4lgt-assembly1_A Crystal structure of the catalytic domain of RluB in complex with a 21-nucleotide RNA substrate |
3dh3-assembly4_D |
1.00 | 0.65 | 3.5e-23 sig | 3dh3-assembly4_D Crystal Structure of RluF in complex with a 22 nucleotide RNA substrate |
1vio-assembly1_B |
1.00 | 0.69 | 3.6e-21 sig | 1vio-assembly1_B Crystal structure of pseudouridylate synthase |
1ksv-assembly1_A |
1.00 | 0.66 | 3.2e-22 sig | 1ksv-assembly1_A STRUCTURE OF RSUA |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 7
| Upstream (5' on genome) | scpB (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | cmk (+ strand, -4 bp gap) |
| Predicted operon |
Rv1707 · Rv1708 · scpA · scpB · Rv1711 · cmk · engA
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: cmk (cytidylate kinase), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1712 cmk |
cytidylate kinase | 997 | 995 ctx | neighborhood:882 fusion:592 coexpression:886 textmining:489 |
Rv1713 engA |
GTPase Der | 995 | 993 ctx | neighborhood:881 cooccurence:704 coexpression:810 |
Rv1710 scpB |
segregation and condensation protein ScpB | 988 | 977 ctx | neighborhood:881 coexpression:814 textmining:509 |
Rv1709 scpA |
segregation and condensation protein ScpA | 964 | 932 ctx | neighborhood:881 coexpression:451 textmining:505 |
Rv1708 |
initiation inhibitor protein | 886 | 887 ctx | neighborhood:881 |
Rv0427c xthA |
exodeoxyribonuclease III protein XthA | 814 | 815 | coexpression:805 |
Rv1707 |
transmembrane protein | 743 | 744 ctx | neighborhood:744 |
Rv1714 |
oxidoreductase | 601 | 601 ctx | neighborhood:520 |
Rv1703c |
methyltransferase | 562 | 563 ctx | neighborhood:544 |
Rv1715 fadB3 |
3-hydroxybutyryl-CoA dehydrogenase FadB | 540 | 540 ctx | neighborhood:519 |
Rv2364c era |
GTPase Era | 546 | 517 ctx | cooccurence:431 |
Rv1716 hyp |
hypothetical protein | 511 | 511 ctx | neighborhood:489 |
Rv1717 hyp |
hypothetical protein | 488 | 488 ctx | neighborhood:476 |
Rv1420 uvrC |
excinuclease ABC subunit UvrC | 481 | 481 ctx | cooccurence:442 |
Rv2440c obg |
GTPase Obg | 518 | 477 ctx | cooccurence:410 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: RNA pseudouridine synthase
- MTBC0 PGAP product: pseudouridine synthase
- Pfam (hmmscan --cut_ga): S4 PF01479.31 (E=3e-13), PseudoU_synth_2 PF00849.28 (E=2e-23)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216227.1)
- Domains: Pfam-A via hmmscan --cut_ga — S4 (PF01479.31), PseudoU_synth_2 (PF00849.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1187 - Curated reference: UniProt P9WHQ1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
cmk - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001821|Rv1711| MMAEPEESREPRGIRLQKVLSQAGIASRRAAEKMIVDGRVEVDGHVVTELGTRVDPQVAVVRVDGARVVLDDSLVYLALNKPRGMHSTMSDDRGRPCIGDLIERKVRGTKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYLATVTGSVPRGLGRTLRAGIELDDGPAFVDDFAVVDAIPGKTLVRVTLHEGRNRIVRRLLAAAGFPVEALVRTDIGAVSLGKQRPGSVRALRSNEIGQLYQAVGL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1711? Email the maintainer — the message is pre-filled with this gene's details.