Rv1700 Resolved · high auto-curated

H37Rv Rv1700 · MTBC0 mtbc0_001808 · 207 aa · 1937597–1938220 (+) · RefSeq NP_216216.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)NUDIX hydrolase
MTBC0 PGAP re-annotationADP-ribose diphosphatase
Revised (this work)ADP-ribose diphosphatase. Pfam: NDPSase_N (PF28549.1), NUDIX (PF00293.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X235 SwissProt · reviewed · Evidence at protein level
UniProt nameADP-ribose pyrophosphatase
EC (curated) EC 3.6.1.13, EC 3.6.1.58
Curated functionCatalyzes the hydrolysis of ADP-ribose (ADPR) to AMP and ribose-5-phosphate. Can also hydrolyze ADP-mannose and ADP-glucose, with lower efficiency. Has weaker activity with NAD, GDP-sugars and UDP-sugars. Also catalyzes the conversion of 8-oxo-dGDP to 8-oxo-dGMP, and 8-oxo-GDP to 8-oxo-GMP. Functions in concert with MutT1 to detoxify 8-oxo-dGTP to 8-oxo-dGMP and may play an important role in supporting cellular growth under oxidative stress. The catalytic efficiency is much higher for the hydrolysis of ADPR than 8-oxo-dGTP, suggesting a more relevant biological role in hydrolysis of ADPR.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namenudF
eggNOG descriptionpfam nudix
Orthologous groupCOG0494
EC number EC 3.6.1.13
KEGG orthology K01515
KEGG pathways map00230

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.724 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NDPSase_NPF28549.1 2.9e-097–40 Nucleoside diphosphate sugar hydrolase N-terminal domain
NUDIXPF00293.35 1.8e-1344–156 NUDIX domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pyrG (CTP synthase), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1699 pyrG CTP synthase 996 983 ctx neighborhood:882 coexpression:862 textmining:817
Rv1701 xerD tyrosine recombinase XerD 996 976 ctx neighborhood:882 coexpression:801 textmining:870
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 952 946 experimental:787 database:643
Rv3211 rhlE ATP-dependent RNA helicase RhlE 784 771 experimental:403 database:615
Rv1253 deaD ATP-dependent RNA helicase DeaD 782 769 experimental:403 database:615
Rv1698 mctB copper transporter MctB 757 758 ctx neighborhood:754
Rv1697 steA hyp hypothetical protein 736 736 ctx neighborhood:733
Rv2524c fas fatty acid synthase 675 663 database:406
Rv1694 tlyA 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA 657 657 ctx neighborhood:648
Rv1340 rphA ribonuclease PH 683 653 database:636
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 671 653 ctx neighborhood:648
Rv1691 hyp hypothetical protein 656 644 ctx neighborhood:451
Rv3339c icd1 isocitrate dehydrogenase 597 597 database:581
Rv2985 mutT1 8-oxo-dGTP diphosphatase 609 582 database:500
Rv1391 dfp bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase 580 581 database:556

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: NUDIX hydrolase
  • MTBC0 PGAP product: ADP-ribose diphosphatase
  • Pfam (hmmscan --cut_ga): NDPSase_N PF28549.1 (E=3e-09), NUDIX PF00293.35 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216216.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NDPSase_N (PF28549.1), NUDIX (PF00293.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0494
  • Curated reference: UniProt I6X235 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 101 functional partner(s); context anchor pyrG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001808|Rv1700|
MAEHDFETISSETLHTGAIFALRRDQVRMPGGGIVTREVVEHFGAVAIVAMDDNGNIPMVYQYRHTYGRRLWELPAGLLDVAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDESVRVYLATGLREVGRPEAHHEEADMTMGWYPIAEAARRVLRGEIVNSIAIAGVLAVHAVTTGFAQPRPLDTEWIDRPTAFAARRAER