xerD Resolved · high auto-curated
H37Rv Rv1701 · MTBC0 mtbc0_001809 ·
311 aa ·
1938217–1939152 MTBC0
(+) ·
RefSeq NP_216217.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | tyrosine recombinase XerD |
|---|---|
| MTBC0 PGAP re-annotation | site-specific tyrosine recombinase XerD |
| Revised (this work) | Site-specific tyrosine recombinase XerD. Pfam: Phage_int_SAM_1 (PF02899.24), Phage_integrase (PF00589.28). |
| Functional category (TubercuList) | insertion seqs and phages |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. leprae (1)).
| Publication | Date |
|---|---|
| Xer recombinase and genome integrity in Helicobacter pylori, a pathogen without topoisomerase IV. doi:10.1371/journal.pone.0033310 | 2012 |
| Complete nucleotide sequence of Klebsiella pneumoniae multiresistance plasmid pJHCMW1. doi:10.1128/AAC.46.11.3422-3427.2002 | 2002 |
| Identification and characterization of a site-specific tyrosine recombinase within the variable loci of Mycoplasma bovis, Mycoplasma pulmonis and Mycoplasma agalactiae. doi:10.1016/s0378-1119(02)00679-0 | 2002 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | nudF (Rv1700, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.50 (95% CI -3.94 to 3.58). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Sequence integration/recombination. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1727
· 100.0% identity |
|---|---|
| M. leprae |
ML1365
· 85.9% identity |
| M. marinum |
MMAR_2506
· 92.2% identity |
| M. smegmatis |
MSMEG_3744
· 86.2% identity |
| M. orygis |
RJtmp_001778
· 100.0% identity |
| M. abscessus |
MAB_2366
· 80.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WF33
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Tyrosine recombinase XerD |
| Curated function | Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC-XerD complex is essential to convert dimers of the bacterial chromosome into monomers to permit their segregation at cell division. It also contributes to the segregational stability of plasmids. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| Preferred name | xerD |
| eggNOG description | Tyrosine recombinase XerD |
| Orthologous group | COG4974 |
| KEGG orthology |
K03733, K04763
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.262 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 90.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 25.2666666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection, day 10 (in vivo) | -4.16 | 0.0053 | required |
| fitness in mouse infection, day 45 (in vivo) | -3.52 | 0.023 | required |
| fitness in mouse infection (in vivo) | +3.33 | 0.0 | disruption advantageous |
| altered fitness under Ethambutol (drug exposure) | -2.38 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 8.5 ppm · rank 2742/3519 (22.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 311 aa |
|---|---|
| Molecular weight | 33.5 kDa |
| Theoretical pI | 10.26 |
| GRAVY | -0.15 (hydrophilic) |
| Aliphatic index | 103.3 |
| Aromaticity | 0.039 |
| Instability index | 35.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Phage_int_SAM_1 | PF02899.24 | 8.8e-21 | 8–98 | Phage integrase, N-terminal SAM-like domain |
Phage_integrase | PF00589.28 | 8.9e-46 | 121–294 | Phage integrase family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1a0p-assembly1_A |
1.00 | 0.53 | 2.3e-15 sig | 1a0p-assembly1_A SITE-SPECIFIC RECOMBINASE, XERD |
5hxy-assembly4_D |
1.00 | 0.60 | 8.0e-14 sig | 5hxy-assembly4_D Crystal structure of XerA recombinase |
5hxy-assembly3_C |
1.00 | 0.59 | 7.7e-14 sig | 5hxy-assembly3_C Crystal structure of XerA recombinase |
5hxy-assembly2_B |
1.00 | 0.59 | 8.8e-14 sig | 5hxy-assembly2_B Crystal structure of XerA recombinase |
5hxy-assembly6_F |
1.00 | 0.60 | 1.3e-13 sig | 5hxy-assembly6_F Crystal structure of XerA recombinase |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv1700 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1702c (- strand, 73 bp gap) |
| Predicted operon |
pyrG · Rv1700 · Rv1701
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1700 (NUDIX hydrolase), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1700 |
NUDIX hydrolase | 996 | 976 ctx | neighborhood:882 coexpression:801 textmining:870 |
Rv1699 pyrG |
CTP synthase | 990 | 932 ctx | neighborhood:882 coexpression:449 textmining:860 |
Rv1697 steA hyp |
hypothetical protein | 766 | 767 ctx | neighborhood:731 |
Rv1698 mctB |
copper transporter MctB | 761 | 761 ctx | neighborhood:754 |
Rv1694 tlyA |
16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA | 646 | 646 ctx | neighborhood:625 |
Rv1695 ppnK |
inorganic polyphosphate/ATP-NAD kinase | 641 | 641 ctx | neighborhood:625 |
Rv2748c ftsK |
DNA translocase FtsK | 717 | 602 ctx | cooccurence:596 |
Rv2584c apt |
adenine phosphoribosyltransferase | 527 | 527 | coexpression:462 |
Rv1696 recN |
DNA repair protein RecN | 546 | 517 ctx | neighborhood:503 |
Rv3754 tyrA |
prephenate dehydrogenase TyrA | 496 | 497 | coexpression:435 |
Rv3917c parB |
chromosome partitioning protein ParB | 517 | 491 ctx | cooccurence:481 |
Rv3242c hyp |
hypothetical protein | 469 | 469 | coexpression:467 |
Rv1423 whiA |
transcriptional regulator WhiA | 448 | 448 | coexpression:448 |
Rv3226c hyp |
hypothetical protein | 454 | 434 | coexpression:434 |
Rv3781 rfbE |
O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE | 420 | 420 | coexpression:420 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: tyrosine recombinase XerD
- MTBC0 PGAP product: site-specific tyrosine recombinase XerD
- Pfam (hmmscan --cut_ga): Phage_int_SAM_1 PF02899.24 (E=9e-21), Phage_integrase PF00589.28 (E=9e-46)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216217.1)
- Domains: Pfam-A via hmmscan --cut_ga — Phage_int_SAM_1 (PF02899.24), Phage_integrase (PF00589.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4974 - Curated reference: UniProt P9WF33 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
Rv1700 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001809|Rv1701|xerD MKTLALQLQGYLDHLTIERGVAANTLSSYRRDLRRYSKHLEERGITDLAKVGEHDVSEFLVALRRGDPDSGTAALSAVSAARALIAVRGLHRFAAAEGLAELDVARAVRPPTPSRRLPKSLTIDEVLSLLEGAGGDKPSDGPLTLRNRAVLELLYSTGARISEAVGLDLDDIDTHARSVLLRGKGGKQRLVPVGRPAVHALDAYLVRGRPDLARRGRGTAAIFLNARGGRLSRQSAWQVLQDAAERAGITAGVSPHMLRHSFATHLLEGGADVRVVQELLGHASVTTTQIYTLVTVHALREVWAGAHPRAR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for xerD? Email the maintainer — the message is pre-filled with this gene's details.