Rv1149 Resolved · medium auto-curated
H37Rv Rv1149 · MTBC0 - ·
135 aa · 1277893–1278300 (+) ·
RefSeq NP_215665.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transposase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Transposase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L0T897
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible transposase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| eggNOG description | Putative transposase of IS4/5 family (DUF4096) |
| Orthologous group | COG3293 |
| KEGG orthology |
K07492
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4096 | PF13340.12 | 1.4e-27 | 7–80 | Putative transposase of IS4/5 family (DUF4096) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1150 (Possible transposase (fragment); Rv1150, (MTCI65.17), len: 183 aa. Possible fragment of transposase (pseudogene). Identical to C-terminal pa), high confidence from genomic context alone (score 954 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1150 |
Possible transposase (fragment); Rv1150, (MTCI65.17), len: 183 aa. Possible fragment of transposase (pseudogene). Identical to C-terminal pa | 953 | 954 ctx | neighborhood:798 cooccurence:774 |
Rv1041c |
IS2-like transposase | 811 | 812 ctx | cooccurence:774 |
Rv1148c hyp |
hypothetical protein | 528 | 527 ctx | neighborhood:526 |
Rv1495 mazF4 |
mRNA interferase MazF4 | 437 | 437 ctx | cooccurence:436 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transposase
- Pfam (hmmscan --cut_ga): DUF4096 PF13340.12 (E=1e-27)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215665.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4096 (PF13340.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3293 - Curated reference: UniProt L0T897 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
4 functional partner(s); context anchor
Rv1150 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1149| MTRVGVISDEFWAVVEPLMPSHEGKPGRRFSDHRLILEGIAWRFRTGSPWRDLPAEFGPWQTVWKRHHRWSLDGTCDEVFAHVAAVFGVDAEVAEDIEKLLSVDSTNVRAHQHSAGACSDTLATGGTVGLQEIRR