Rv1042c Resolved · medium auto-curated

H37Rv Rv1042c · MTBC0 - · 135 aa · 1165092–1165499 (-) · RefSeq NP_215558.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)IS2-like transposase
MTBC0 PGAP re-annotation
Revised (this work)IS2-like transposase.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0T897 TrEMBL · unreviewed · Predicted
UniProt namePossible transposase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionPutative transposase of IS4/5 family (DUF4096)
Orthologous groupCOG3293
KEGG orthology K07492

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4096PF13340.12 1.4e-277–80 Putative transposase of IS4/5 family (DUF4096)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1041c (IS2-like transposase), high confidence from genomic context alone (score 958 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1041c IS2-like transposase 957 958 ctx neighborhood:798 cooccurence:774
Rv1150 Possible transposase (fragment); Rv1150, (MTCI65.17), len: 183 aa. Possible fragment of transposase (pseudogene). Identical to C-terminal pa 805 806 ctx cooccurence:774
Rv1495 mazF4 mRNA interferase MazF4 437 437 ctx cooccurence:436
Rv1043c hyp hypothetical protein 425 425 ctx neighborhood:421

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): IS2-like transposase
  • Pfam (hmmscan --cut_ga): DUF4096 PF13340.12 (E=1e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215558.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4096 (PF13340.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3293
  • Curated reference: UniProt L0T897 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor Rv1041c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1042c|
MTRVGVISDEFWAVVEPLMPSHEGKPGRRFSDHRLILEGIAWRFRTGSPWRDLPAEFGPWQTVWKRHHRWSLDGTCDEVFAHVAAVFGVDAEVAEDIEKLLSVDSTNVRAHQHSAGACSDTLATGGTVGLQEIRR