lipI Family assigned · medium auto-curated

H37Rv Rv1400c · MTBC0 mtbc0_001501 · 320 aa · 1585178–1586140 (-) · RefSeq NP_215916.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipase
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: BD-FAE (PF20434.6), COesterase (PF00135.35), Abhydrolase_3 (PF07859.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71668 SwissProt · reviewed · Evidence at protein level
UniProt nameEsterase LipI
EC (curated) EC 3.1.1.-
Curated functionEsterase that can hydrolyze short-chain esters with the carbon chain containing 2 to 12 carbon atoms. In vitro, pNP-butyrate is the preferred substrate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namelipI
eggNOG descriptionPFAM Alpha beta hydrolase
Orthologous groupCOG0657
KEGG orthology K01066

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.791 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BD-FAEPF20434.6 3.2e-2072–179 BD-FAE
COesterasePF00135.35 5.0e-1172–174 Carboxylesterase family
Abhydrolase_3PF07859.20 2.3e-7387–294 alpha/beta hydrolase fold

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nlhH (carboxylesterase NlhH), high confidence from genomic context alone (score 866 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1399c nlhH carboxylesterase NlhH 871 866 ctx neighborhood:827
Rv2385 mbtJ acetyl hydrolase 773 773 ctx cooccurence:773
Rv1401 membrane protein 718 718 ctx neighborhood:711
Rv3097c lipY triacylglycerol lipase Lip 776 561 ctx cooccurence:561 textmining:511
Rv1402 priA primosomal protein N' 553 553 ctx neighborhood:548
Rv1398c vapB10 antitoxin VapB10 544 544 ctx neighborhood:543
Rv1397c vapC10 ribonuclease VapC10 543 543 ctx neighborhood:543
Rv2485c lipQ carboxylesterase LipQ 794 493 ctx cooccurence:490 textmining:612
Rv0722 rpmD 50S ribosomal protein L30 493 493 database:490
Rv2284 lipM esterase LipM 895 491 ctx cooccurence:483 textmining:803
Rv2903c lepB signal peptidase 501 482 database:464
Rv0310c hyp hypothetical protein 479 475 experimental:439
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 455 456 experimental:440
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 476 453 experimental:441
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 448 449 experimental:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipase
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): BD-FAE PF20434.6 (E=3e-20), COesterase PF00135.35 (E=5e-11), Abhydrolase_3 PF07859.20 (E=2e-73)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215916.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BD-FAE (PF20434.6), COesterase (PF00135.35), Abhydrolase_3 (PF07859.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt P71668 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor nlhH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001501|Rv1400c|lipI
MPSLDNTADEKPAIDPILLKVLDAVPFRLSIDDGIEAVRQRLRDLPRQPVHPELRVVDLAIDGPAGPIGTRIYWPPTCPDQAEAPVVLYFHGGGFVMGDLDTHDGTCRQHAVGADAIVVSVDYRLAPEHPYPAAIEDAWAATRWVAEHGRQVGADLGRIAVAGDSAGGTIAAVIAQRARDMGGPPIVFQLLWYPSTLWDQSLPSLAENADAPILDVKAIAAFSRWYAGEIDLHNPPAPMAPGRAENLADLPPAYIAVAGYDPLRDDGIRYGELLAAAGVPVEVHNAQTLVHGYVGYAGVVPAATEATNRGLVALRVVLHG