lipI Family assigned · medium auto-curated
H37Rv Rv1400c · MTBC0 mtbc0_001501 ·
320 aa ·
1585178–1586140 MTBC0
(-) ·
RefSeq NP_215916.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipase |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. Pfam: BD-FAE (PF20434.6), COesterase (PF00135.35), Abhydrolase_3 (PF07859.20). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| The Protein Expression Level of a Heterogeneous Gene Inserted in LIPI-1 of the Listeria ivanovii Genome Relies on Its Insertion Orientation. doi:10.1159/000480637 | 2017 |
| Mycobacterium tuberculosis rv1400c encodes functional lipase/esterase. doi:10.1016/j.pep.2016.04.013 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Central Carbon Metabolism.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.66 (95% CI -3.07 to 5.30). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown, but possibly involved in lipid metabolism |
|---|---|
| Mycobrowser EC |
3.1.-.-
· superseded EC numbering; the atlas uses the current class (3.1.1.-)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1435c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2209
· 80.6% identity |
| M. smegmatis |
MSMEG_3059
· 64.1% identity |
| M. orygis |
RJtmp_001480
· 100.0% identity |
| M. abscessus |
MAB_2814
· 53.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P71668
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Esterase LipI |
| EC (curated) |
EC 3.1.1.-
|
| Curated function | Esterase that can hydrolyze short-chain esters with the carbon chain containing 2 to 12 carbon atoms. In vitro, pNP-butyrate is the preferred substrate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | lipI |
| eggNOG description | PFAM Alpha beta hydrolase |
| Orthologous group | COG0657 |
| KEGG orthology |
K01066
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.791 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 77.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 40.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 19 in the ORF — 0 in the essential state, 0 growth-defect, 19 non-essential, 0 growth-advantage. Saturation 0.842, mean read count 41.1875. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 144.0 ppm · rank 1030/3519 (70.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 320 aa |
|---|---|
| Molecular weight | 34.1 kDa |
| Theoretical pI | 4.83 |
| GRAVY | 0.039 (hydrophobic) |
| Aliphatic index | 99.8 |
| Aromaticity | 0.069 |
| Instability index | 41.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BD-FAE | PF20434.6 | 3.2e-20 | 72–179 | BD-FAE |
COesterase | PF00135.35 | 5.0e-11 | 72–174 | Carboxylesterase family |
Abhydrolase_3 | PF07859.20 | 2.3e-73 | 87–294 | alpha/beta hydrolase fold |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6k34-assembly4_D |
1.00 | 0.97 | 2.2e-45 sig | 6k34-assembly4_D Crystal Structure of DphMB1 |
4ypv-assembly1_A |
1.00 | 0.90 | 3.4e-34 sig | 4ypv-assembly1_A High-resolution structure of a metagenome-derived esterase Est8 |
1evq-assembly1_A |
1.00 | 0.90 | 1.7e-31 sig | 1evq-assembly1_A THE CRYSTAL STRUCTURE OF THE THERMOPHILIC CARBOXYLESTERASE EST2 FROM ALICYCLOBACILLUS ACIDOCALDARIUS |
2hm7-assembly1_A |
1.00 | 0.83 | 1.3e-33 sig | 2hm7-assembly1_A Crystal Structure Analysis of the G84S EST2 mutant |
7wol-assembly1_B |
1.00 | 0.90 | 2.1e-31 sig | 7wol-assembly1_B Crystal structure of lipase TrLipB from Thermomocrobium roseum |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | nlhH (- strand, 24 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1401 (+ strand, 133 bp gap) |
| Predicted operon |
nlhH · lipI
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: nlhH (carboxylesterase NlhH), high confidence from genomic context alone (score 866 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1399c nlhH |
carboxylesterase NlhH | 871 | 866 ctx | neighborhood:827 |
Rv2385 mbtJ |
acetyl hydrolase | 773 | 773 ctx | cooccurence:773 |
Rv1401 |
membrane protein | 718 | 718 ctx | neighborhood:711 |
Rv3097c lipY |
triacylglycerol lipase Lip | 776 | 561 ctx | cooccurence:561 textmining:511 |
Rv1402 priA |
primosomal protein N' | 553 | 553 ctx | neighborhood:548 |
Rv1398c vapB10 |
antitoxin VapB10 | 544 | 544 ctx | neighborhood:543 |
Rv1397c vapC10 |
ribonuclease VapC10 | 543 | 543 ctx | neighborhood:543 |
Rv2485c lipQ |
carboxylesterase LipQ | 794 | 493 ctx | cooccurence:490 textmining:612 |
Rv0722 rpmD exp |
50S ribosomal protein L30 | 493 | 493 | database:490 |
Rv2284 lipM |
esterase LipM | 895 | 491 ctx | cooccurence:483 textmining:803 |
Rv2903c lepB exp |
signal peptidase | 501 | 482 | database:464 |
Rv0310c hyp exp |
hypothetical protein | 479 | 475 | experimental:439 |
Rv3153 nuoI exp |
NADH-quinone oxidoreductase subunit I | 455 | 456 | experimental:440 |
Rv3151 nuoG exp |
NADH-quinone oxidoreductase subunit G | 476 | 453 | experimental:441 |
Rv3150 nuoF exp |
NADH-quinone oxidoreductase subunit F | 448 | 449 | experimental:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipase
- MTBC0 PGAP product: alpha/beta hydrolase
- Pfam (hmmscan --cut_ga): BD-FAE PF20434.6 (E=3e-20), COesterase PF00135.35 (E=5e-11), Abhydrolase_3 PF07859.20 (E=2e-73)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215916.1)
- Domains: Pfam-A via hmmscan --cut_ga — BD-FAE (PF20434.6), COesterase (PF00135.35), Abhydrolase_3 (PF07859.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt P71668 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
52 functional partner(s); context anchor
nlhH - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001501|Rv1400c|lipI MPSLDNTADEKPAIDPILLKVLDAVPFRLSIDDGIEAVRQRLRDLPRQPVHPELRVVDLAIDGPAGPIGTRIYWPPTCPDQAEAPVVLYFHGGGFVMGDLDTHDGTCRQHAVGADAIVVSVDYRLAPEHPYPAAIEDAWAATRWVAEHGRQVGADLGRIAVAGDSAGGTIAAVIAQRARDMGGPPIVFQLLWYPSTLWDQSLPSLAENADAPILDVKAIAAFSRWYAGEIDLHNPPAPMAPGRAENLADLPPAYIAVAGYDPLRDDGIRYGELLAAAGVPVEVHNAQTLVHGYVGYAGVVPAATEATNRGLVALRVVLHG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lipI? Email the maintainer — the message is pre-filled with this gene's details.