Rv0940c Family assigned · medium auto-curated

H37Rv Rv0940c · MTBC0 mtbc0_000998 · 288 aa · 1053810–1054676 (-) · RefSeq NP_215455.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotationTIGR03619 family F420-dependent LLM class oxidoreductase
Revised (this work)TIGR03619 family F420-dependent LLM class oxidoreductase. Pfam: Bac_luciferase (PF00296.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKP1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0940c

UniProt still lists this protein as Uncharacterized protein Rv0940c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionCOG2141 Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases
Orthologous groupCOG2141
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.434 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.13% of strains (196) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_luciferasePF00296.27 3.8e-4311–226 Luciferase-like monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3520c (coenzyme F420-dependent oxidoreductase), high confidence from genomic context alone (score 870 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3520c coenzyme F420-dependent oxidoreductase 870 870 ctx neighborhood:544 cooccurence:726
Rv3521 hyp hypothetical protein 799 792 ctx neighborhood:544 cooccurence:559
Rv3522 ltp4 lipid transfer protein 750 750 ctx neighborhood:544 cooccurence:471
Rv3072c hyp hypothetical protein 722 722 ctx cooccurence:722
Rv3523 ltp3 lipid carrier protein 668 668 ctx neighborhood:544
Rv3178 nitroreductase 685 665 ctx cooccurence:663
Rv3531c hyp hypothetical protein 630 631 ctx cooccurence:627
Rv0941c hyp hypothetical protein 622 622 ctx neighborhood:601
Rv2951c phthiodiolone/phenolphthiodiolone dimycocerosates ketoreductase 635 616 ctx cooccurence:615
Rv3547 ddn deazaflavin-dependent nitroreductase 634 611 ctx cooccurence:611
Rv1261c hyp hypothetical protein 610 610 ctx cooccurence:608
Rv3529c hyp hypothetical protein 602 600 ctx cooccurence:593
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 591 592 ctx cooccurence:572
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 583 583 ctx cooccurence:575
Rv1817 flavoprotein 548 548 ctx cooccurence:535

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: oxidoreductase
  • MTBC0 PGAP product: TIGR03619 family F420-dependent LLM class oxidoreductase
  • Pfam (hmmscan --cut_ga): Bac_luciferase PF00296.27 (E=4e-43)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215455.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_luciferase (PF00296.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2141
  • Curated reference: UniProt P9WKP1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor Rv3520c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000998|Rv0940c|
MRFSYAEAMTDFTFYIPLAKAAEAAGYSSMTIPDSIAYPFESDSKYPYTPDGNREFMDGKPFIETFVLTAALGAVTTRLRFNFFVLKLPIRPPALVAKQAGSLAALIGNRVGLGVGTSPWPEDYELMGVPFAKRGKRIDECIEIVRGLTTGDYFEFHGEFYDIPKTKMTPAPTQPIPILVGGHADAALRRAARADGWMHGGGDPDELDRLIARVKRLREEAGKTSPFEIHVISLDGFTVDGVKRLEDKGVTDVIVGFRVPYTMGPDTEPLQTKIRNLEMFAENVIAKV