Rv1351 Still unknown · low auto-curated
H37Rv Rv1351 · MTBC0 - ·
109 aa · 1518231–1518560 (+) ·
RefSeq NP_215867.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WM17
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv1351 |
UniProt still lists this protein as Uncharacterized protein Rv1351; the revised annotation above is ahead of the current UniProt record.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.746 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 7 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (302) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fabG2 (3-oxoacyl-ACP reductase FabG), high confidence from genomic context alone (score 776 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1350 fabG2 |
3-oxoacyl-ACP reductase FabG | 776 | 776 ctx | neighborhood:773 |
Rv1349 irtB |
iron ABC transporter ATP-binding protein/permease IrtB | 495 | 496 ctx | neighborhood:494 |
Rv1348 irtA |
iron ABC transporter ATP-binding protein/permease IrtA | 494 | 495 ctx | neighborhood:494 |
Rv1352 hyp |
hypothetical protein | 922 | 462 ctx | neighborhood:459 textmining:861 |
Rv0899 arfA |
peptidoglycan-binding protein ArfA | 544 | 51 | textmining:540 |
Rv2270 lppN |
lipoprotein LppN | 810 | 47 | textmining:809 |
Rv1973 |
Mce associated membrane protein | 865 | 44 | textmining:865 |
Rv1970 lprM |
Mce family lipoprotein LprM | 803 | 44 | textmining:803 |
Rv1698 mctB |
copper transporter MctB | 755 | 44 | textmining:755 |
Rv1968 mce3C |
Mce family protein Mce3C | 805 | 42 | textmining:805 |
Rv0431 |
tuberculin-like peptide | 870 | 41 | textmining:870 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215867.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt P9WM17 (SwissProt, reviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 31.4, very low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
11 functional partner(s); context anchor
fabG2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1351| MTPRSLPRYGNSSRRKSFPMHRPSNVATATRKKSSIGWVLLACSVAGCKGIDTTEFILGRAGAFELAVRAAQHRHRYLTMVNVGRAPPRRCRTVCMAATDTPRNIRLNG